KEGG   Clostridium pasteurianum BC1: Clopa_4537Help
Entry
Clopa_4537        CDS       T02645                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Clopa_4537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpas01007]
    Clopa_4537
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpas03016]
    Clopa_4537
Enzymes [BR:cpas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Clopa_4537
Amino acid related enzymes [BR:cpas01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Clopa_4537
Transfer RNA biogenesis [BR:cpas03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Clopa_4537
 Prokaryotic Type
    Clopa_4537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: AGK99244
UniProt: R4KFC1
Position
complement(4597741..4599138)
Genome map
AA seq 465 aa AA seqDB search
MKIFNTMSKKKEEFVPINPGKVKMYVCGPTVYNFFHIGNARTFIIFDTVRRYFEYKGYKV
SFVQNFTDIDDRMINKANQDGISIKELGDRFISEYYKDADGLYIERATANPRATEFIQDI
ISFVSDLIDKGYAYEIDGDVYFSTEKFKNYGKLSGQNLEELESGVRINVDERKKDPMDFA
IWKTQKDGEPAWESPWGPGRPGWHIECSCMAHKLLGDTIDIHAGGMDLVFPHHENEIAQS
ESRNGKKFANYWMHSAYLNVNNQKMSKSLNNFLTARDALKKFDPEVIRFLMLSAHYRTQL
NYSPDLLESDRSALERLYNSIYNLENLLEKTNMDKLKDGEKVYLDNLNSYRDKYVEKMED
DFNTADAISVIFDLVRDINSNLGIESSKEIIETSLNLIRELGKPLGILQKSTKVNLEEEI
EKLIEKRQKARKEKNFALSDKIRDDLKAKGIILLDTPEGVRWKKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttaatacaatgtctaaaaaaaaggaagaatttgtaccaattaatcctgga
aaagttaagatgtacgtctgcgggcctacggtttataatttttttcatataggtaatgca
agaacatttattatatttgatacagtaagaaggtattttgaatataaaggttataaagta
agctttgtacaaaattttacggatattgatgataggatgataaataaggcaaatcaagat
ggaataagcattaaagaattaggggacagatttatttctgaatattataaagatgcagat
gggttatatatagagagagctactgcaaatccaagagcaacagaatttattcaggatatt
ataagttttgttagtgatcttattgataaaggatatgcctatgaaattgacggagatgtt
tattttagtactgaaaagtttaaaaattatggtaaattgtcgggacaaaatttagaagaa
ttagaaagtggagtaagaataaacgtagatgaaagaaaaaaagaccctatggattttgct
atatggaaaacgcaaaaggatggtgaaccagcatgggaaagtccatggggacctggaaga
ccgggatggcatatagaatgctcttgcatggcacataagttattaggtgatactatagat
attcatgctggtggtatggatttggtttttccacatcatgaaaatgaaattgcgcaaagc
gaaagtagaaacggcaaaaaatttgccaactattggatgcattctgcttatttaaatgta
aataatcaaaagatgtcaaaatctttaaataattttttgacggcgagagatgcgcttaaa
aaatttgatcctgaagttataagattccttatgctaagtgcacactatagaactcaatta
aattacagtcctgacctattggagtcagatagatcagcccttgagagattgtataattct
atctataatttagaaaatctattagaaaagactaatatggataaattaaaagatggagaa
aaggtatatttggataatttaaattcctatagagataaatatgttgaaaaaatggaggac
gattttaatactgcggatgccatttccgtgatatttgacttagtgagggatataaattcc
aatttgggtattgaatcttcaaaagagattatagaaacttctcttaatttaattagagaa
ttgggaaaacctcttggaatacttcagaagtctacaaaagttaatttagaggaagaaata
gaaaaattaatcgagaaaaggcaaaaagctagaaaggaaaagaattttgctctttcagat
aaaataagggatgatttaaaagcaaagggtataatacttttagatacgccagaaggtgta
agatggaaaaaagcatga

DBGET integrated database retrieval system