KEGG   Clostridium pasteurianum BC1: Clopa_4556Help
Entry
Clopa_4556        CDS       T02645                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cpas  Clostridium pasteurianum BC1
Pathway
cpas00471  D-Glutamine and D-glutamate metabolism
cpas00550  Peptidoglycan biosynthesis
cpas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Clopa_4556
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clopa_4556
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpas01011]
    Clopa_4556
Enzymes [BR:cpas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Clopa_4556
Peptidoglycan biosynthesis and degradation proteins [BR:cpas01011]
 Precursor biosynthesis
  Amino acid ligase
   Clopa_4556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Oxidored_nitro Pyr_redox DUF5103 AlaDh_PNT_C CbiA
Motif
Other DBs
NCBI-ProteinID: AGK99256
UniProt: R4KC31
Position
complement(4616959..4618338)
Genome map
AA seq 459 aa AA seqDB search
MSRNFSDFKRFINNKKTVVLGIGISNRPLIDFLLELGAEVTAFDRKTKKQIGHAADELME
KGVKLILGENYLEFLQGYEVIFKTPSMRIDIPELIRAKKSGAYITSEMEEFVKYCPAKII
GVTGSDGKTTTTTLIYNILKEEGYKTWVGGNIGTPLFTKIRDINEKDKVVLELSSFQLMT
MNVSPQVSIITNLSPNHLDIHKDMEEYIDAKKNIYKFQNQDGLLILNQDNRITSTMANEA
NGKVMEFSTKYKLENGAYFYGGKLYVLNKFVCKREEIVIKGMHNVENFLAAFCATIGDAS
IDTMKKVAVTFSGVEHRSEFVRELNGVKYYNDSIASSPTRTLASLRAFEKKVILIAGGYD
KHIPFEPLAEEGLNMIKKLILLGNTKDKIEESFNKVMKDKKVYIPIVKVDTLEEAVNMAR
KKAEAEDIVTLSPSCASFDMFPNFEIRGNKFKEIVNSMK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaattttagtgattttaaaagattcataaataacaagaaaactgtggtttta
ggtataggtataagcaatagacctctaatagactttttgttagaattaggagctgaagtt
acagcttttgataggaagacaaaaaaacagataggacatgcagcagatgaacttatggaa
aaaggggtaaagttaattttaggagaaaattatttagaattccttcaaggatatgaagtt
atatttaagacaccttctatgaggatagatattccagagttaattagagcaaaaaaatca
ggagcatatataacctctgaaatggaggaatttgttaaatattgtcctgctaaaattatt
ggagttactggcagtgatggcaaaactactacaacaacattaatatataatattcttaaa
gaagaaggatataagacatgggtaggaggtaatataggaactcctctatttactaaaatc
agagatataaatgaaaaagataaagtggtcttggaattatccagttttcaactcatgact
atgaatgtatcacctcaggtatctatcataacaaatttgagtccaaatcatttggatatt
cacaaagatatggaagaatatatagatgcaaaaaagaacatatataaatttcaaaatcaa
gatggactgcttatattaaatcaagataaccgtattacatcgactatggctaatgaagca
aatggaaaggttatggagtttagtacaaaatataagttagaaaatggagcatatttctat
ggtggaaaattatatgtattaaataaatttgtttgtaaaagagaagagatagtaataaag
ggaatgcataatgtggaaaactttcttgcagctttttgtgctactataggagatgctagt
attgatactatgaaaaaagtagcggttacattttcaggtgttgagcatagatccgaattt
gtaagagaattaaatggagtcaaatattataatgattctattgcatctagtccaactaga
acattggcaagtttgagagctttcgagaaaaaggtaatactaattgctggtggatatgat
aaacatattccctttgaacctttagcagaagaaggtttaaatatgataaaaaaattaata
cttttaggaaacacaaaagataagattgaagagagctttaataaggtaatgaaggataaa
aaagtatatattccaatagttaaagttgacacattagaagaagctgtaaatatggctaga
aagaaagcagaagcagaagatatagtcacgctttctccatcttgtgctagtttcgatatg
ttccccaattttgagatcagaggaaacaaatttaaagaaattgtaaatagtatgaaatag

DBGET integrated database retrieval system