KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c03100Help
Entry
CLPA_c03100       CDS       T03753                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpat00450  Selenocompound metabolism
cpat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CLPA_c03100 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpat03016]
    CLPA_c03100 (selD)
Enzymes [BR:cpat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CLPA_c03100 (selD)
Transfer RNA biogenesis [BR:cpat03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CLPA_c03100 (selD)
 Prokaryotic Type
    CLPA_c03100 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AJA50398
UniProt: A0A0H3J647
Position
333416..334450
Genome map
AA seq 344 aa AA seqDB search
MEKKNSEFSCGGGCSAKLAPGFLQKILKNIPNRFDENLLIGFDSSDDAAVYKLTEDIAII
QTLDFFTPIVEDPYTFGKIAAANALSDVYAMGGEVKTALNIVCFPERLEGEILAEILRGG
AEKVQEAGGIVCGGHSINDDKPKYGLSVTGIINPKKILPNNNCSIGDKIILTKPLGVGII
TTANKVGEADETAYRKAIKSMETLNKYAAEKIKKYKVNACTDVTGFGFLGHLNEMASTEY
TISVDVNSVPYIEEAYDYAKEFFITAAGQKNRKHLLEKVKLENIEFAIEEILFDPQTSGG
LLASVDKFQAEDLIKDLNELEIKSQIVGEVIERQDVNIIVEASS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaaagaattcagaattctcctgtggaggaggatgcagtgcaaaactggcacca
ggatttttgcaaaagatacttaaaaatattccaaatagatttgatgagaatctgcttata
ggttttgacagctcagatgatgcagcagtttataaactcactgaggacatagctataata
caaactttagatttttttacacctatagttgaggatccctatacctttgggaaaatagct
gctgccaatgctcttagtgatgtctatgccatgggaggagaggttaaaactgctcttaac
atagtatgttttccagaaagattagagggagaaatacttgcagaaatattgagaggtggt
gccgaaaaggttcaggaagcagggggaatagtatgtggaggacattccataaatgatgat
aagcctaaatatggattgtctgtaactggaataataaatcctaaaaaaatacttcccaat
aataactgtagtataggagataagattatacttacaaaaccactgggagtgggcataata
accactgccaataaggtaggagaagccgatgaaactgcttatagaaaagctataaagtct
atggaaactttaaataaatatgctgcagaaaagattaaaaaatataaagttaatgcttgt
acagatgtaacgggttttggatttttgggacatttaaatgaaatggcaagtactgagtat
actatttctgtggatgtaaacagtgttccatatattgaagaagcttatgactatgcgaag
gaattttttataaccgccgcagggcaaaagaatagaaaacatcttcttgaaaaagttaaa
cttgaaaatattgaatttgctatagaagaaatactatttgatccacagacttccggcgga
cttttagcaagtgtggataaatttcaggcagaagatctaataaaagatttaaatgaactt
gaaataaagtctcaaatagtgggagaagtaatagagagacaggatgtaaacataatagtt
gaagcaagttcttaa

DBGET integrated database retrieval system