KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c37190Help
Entry
CLPA_c37190       CDS       T03753                                 

Gene name
glyQS
Definition
(GenBank) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpat00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cpat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLPA_c37190 (glyQS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpat01007]
    CLPA_c37190 (glyQS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpat03016]
    CLPA_c37190 (glyQS)
   03029 Mitochondrial biogenesis [BR:cpat03029]
    CLPA_c37190 (glyQS)
Enzymes [BR:cpat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     CLPA_c37190 (glyQS)
Amino acid related enzymes [BR:cpat01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CLPA_c37190 (glyQS)
Transfer RNA biogenesis [BR:cpat03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CLPA_c37190 (glyQS)
Mitochondrial biogenesis [BR:cpat03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CLPA_c37190 (glyQS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b Lipase_GDSL_lke Zn_Tnp_IS1595 HypA zinc_ribbon_15
Motif
Other DBs
NCBI-ProteinID: AJA53753
UniProt: A0A0H3JBI0
Position
complement(3979931..3981322)
Genome map
AA seq 463 aa AA seqDB search
MSFEKTMDKIVSLAKNRGFIFPGSDIYGGLANSWDYGPLGVELKNNVKKTWWKKFIQESS
YNVGIDCAILMNSEVWVASGHVGGFSDPLMDCKDCKSRFRADKLVEEHMAEQGIDDVSAD
GFTNEELKDYIEKNNIVCPKCGKSNFTDIRKFNLMFKTFQGVTEDAKSEIFLRPETAQGI
FVNFKNVQRSSRKKVPFGIGQIGKAFRNEITPGNFTFRTREFEQMELEFFCKPGTDLEWF
NYWKDYSFNFLLNLGANKENLRIRDHSPEELVFYSKATSDIEYKFPFGWGELWGIADRTD
YDLTKHMDHSGEDLNYLDPSTNEKYIPYVIEPSLGADRVTLAFLVDAYDEEELEGGETRT
VLHLHPALAPFKAAILPLSKKLSDKSMEVYDKLSKTFNVDYDEAGSIGKRYRREDEIGTP
YCITIDFDTLEDESVTVRDRDTMKQVRIKIEDLEKFIEDKLSF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaaaaaacaatggataagatagtttcacttgcaaaaaatagaggatttata
tttcctgggtctgatatatatggaggattggcaaattcttgggattatggtcctttagga
gttgaacttaaaaataatgtgaaaaaaacttggtggaaaaaatttatacaagaaagttcc
tataatgttggaattgattgtgctatactcatgaatagtgaggtgtgggtagcctcaggt
catgttggtggattttcggacccacttatggattgtaaagattgtaaatcaagatttaga
gctgataaacttgtagaagagcatatggcagaacaaggcatagatgatgtaagtgctgat
ggttttacaaatgaagagttaaaggattatatagagaaaaacaacatagtttgtcctaaa
tgtggtaaaagtaattttactgatataagaaaatttaacttaatgtttaaaacatttcag
ggagttacagaagatgctaaatctgaaatatttttgagaccggaaacagctcaggggata
tttgtaaattttaaaaatgttcaaagaagctcaagaaaaaaagttccttttggtataggt
caaattggtaaggcttttagaaatgaaattacacctgggaattttacttttagaacaaga
gagtttgaacagatggaattggagtttttctgcaagccaggaactgatttagagtggttc
aattattggaaagattatagctttaactttttattgaatttaggtgctaataaggaaaac
ttaagaattagagatcattccccagaagaattggttttttatagtaaggcaacttctgat
atagaatataaattcccttttggatggggagaattatggggaatagcagatagaactgat
tatgacttaactaagcatatggatcattcaggagaagacttaaactacttggatccatct
actaatgaaaaatatataccttatgttattgaaccatcattaggagcagatagagtgaca
ttggcatttttagtagatgcttatgatgaagaagagcttgaaggtggagagacaagaact
gttctacatttacatccagctttagcaccatttaaagcagcaatacttccgcttagtaag
aaactttcagataaatctatggaagtatatgataaattaagtaaaacatttaatgtggat
tatgatgaagctggaagtataggtaaaagatatagaagagaagatgagataggaactcct
tattgtataactatagattttgatactctagaggatgagtctgttactgtcagagataga
gacactatgaagcaagtaagaataaaaatagaagatttagaaaaatttatagaagataaa
ttgagtttttag

DBGET integrated database retrieval system