KEGG   Cupriavidus pauculus: EHF44_02295Help
Entry
EHF44_02295       CDS       T05738                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00860  Porphyrin and chlorophyll metabolism
cpau01100  Metabolic pathways
cpau01110  Biosynthesis of secondary metabolites
cpau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EHF44_02295 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpau01007]
    EHF44_02295 (hemL)
Enzymes [BR:cpau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     EHF44_02295 (hemL)
Amino acid related enzymes [BR:cpau01007]
 Aminotransferase (transaminase)
  Class III
   EHF44_02295 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZG12342
UniProt: A0A3G8GYH3
Position
1:128132..129424
Genome map
AA seq 430 aa AA seqDB search
MSRNQQLFDRAQQTIPGGVNSPVRAFRSVGGTPRFITRAQGAYMWDADGQQYIDYIGSWG
PMIVGHAHPDVVRAVQETAAHSFSFGAPTEAEIVMAEEICKLVPSIEQVRLVSSGTEATM
SALRLARGFTGRDLIIKFEGCYHGHADSLLVKAGSGLLTFADTTQNAPSSAGVPADVTRH
TMVLEYNNVAQLEEAFARHKGEIAAVIVEVVAGNMNLVRASQAFLQTMRNLCSEHGSVLI
FDEVMTGFRVALGGAQAHYGIRPDMTCLGKVIGGGMPAAAFGGRRDIMAKLAPLGGVYQA
GTLSGNPLAVAAGLATLKLIQAPGFYDRLAAQTRKLADGLTAAARAAGVPFCADAIGGMF
GLYFTHDVPASFAEVTQADVGRFNRFFHAMLAEGVYLAPSAFEAGFVSACHDDAIIDQTI
RAAETAFRAG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaaccagcagctcttcgaccgcgcccagcagaccattcccggcggcgtcaat
tcgcccgtgcgcgccttccgttccgtcggcggcacgccgcgcttcatcacccgggcccag
ggcgcgtacatgtgggacgccgacggccagcagtacatcgactacatcggctcctggggc
ccgatgatcgtcggccacgcccacccggacgtggtacgcgccgtgcaggaaaccgccgcg
cacagcttttcgttcggcgccccgaccgaggccgagatcgtgatggccgaggaaatctgc
aagctcgtgccgtcgatcgagcaggtgcggctggtgtcgtcgggcaccgaggccaccatg
agcgcgctgcggctggcgcgcggcttcacgggccgggacctgatcatcaagttcgagggc
tgctaccacggccacgccgacagcctgctggtcaaggccggctcgggcctgctgaccttt
gccgataccacgcagaacgcgccgtcgtcggccggcgtgcccgccgacgtcacgcgccac
acgatggtgctggagtacaacaacgtcgcccagctcgaagaagcgttcgcgcgccacaag
ggcgagatcgcggcggtcatcgtcgaggtcgtggccggcaacatgaacctggtgcgcgcc
agccaggcgttcctgcagaccatgcgcaacctgtgcagcgagcacggcagcgtgctgatc
tttgacgaagtgatgaccggcttccgcgtggcgctgggcggcgcgcaggcgcactacggc
atccgcccggacatgacctgcctgggcaaggtgattggcggcggcatgccggcggcggcg
ttcggcggccggcgcgacatcatggccaagctggcgccgctgggcggcgtctaccaggct
ggcacgctgtccggcaacccgctggccgtggcggccggcctggccacgctgaagctgatc
caggcgccgggcttctacgaccggctggccgcccagacccgcaagctggccgacggcctc
accgccgccgcccgcgcggccggcgtgccgttctgcgccgacgccatcggcggcatgttc
ggcctgtacttcacccacgacgtgccggccagctttgccgaggtcacccaggccgacgtc
ggccgcttcaaccgcttcttccacgccatgctggccgaaggcgtctacctggccccgtcg
gcgttcgaggccggctttgtctcggcctgccacgacgacgcgatcatcgaccagacgatc
cgggcagccgagacggcgttccgcgccgggtga

DBGET integrated database retrieval system