KEGG   Cupriavidus pauculus: EHF44_07470Help
Entry
EHF44_07470       CDS       T05738                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cpau  Cupriavidus pauculus
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EHF44_07470 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AZG13296
UniProt: A0A3G8GYF6
Position
1:1250442..1250816
Genome map
AA seq 124 aa AA seqDB search
MSEYAFSVAVRTQYMADQSDPDRGRYAFAYTITIHNTGEVAAQLISRHWIITDSDNATQE
VAGLGVVGHQPLLKPGEHFEYSSWATISTPVGSMKGEYFCVAEDGHRFEVPIPEFALVLP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtacgctttttccgtggccgtgcgcacccagtacatggccgaccagtcggac
cccgaccgcgggcgctacgcgtttgcctacaccatcaccatccacaacaccggcgaggtg
gccgcgcagctgatctcgcgccactggatcatcacggacagcgacaacgccacgcaggaa
gtggcggggctgggcgtggtgggccaccagccgctgctcaagccgggcgagcacttcgag
tattcgagctgggcgacgatctcgacgccggtcgggtcgatgaagggcgagtacttctgc
gtggccgaggacgggcaccgcttcgaggtgccgattccggaattcgcgctggtgctgccg
cgcatgctccattga

DBGET integrated database retrieval system