KEGG   Cupriavidus pauculus: EHF44_19595Help
Entry
EHF44_19595       CDS       T05738                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00030  Pentose phosphate pathway
cpau01100  Metabolic pathways
cpau01120  Microbial metabolism in diverse environments
cpau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EHF44_19595
Enzymes [BR:cpau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     EHF44_19595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase F420_oxidored GDP_Man_Dehyd Sacchrp_dh_NADP ApbA NAD_binding_10 PALP 3Beta_HSD 2-Hacid_dh_C THF_DHG_CYH_C NAD_binding_7 Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 DUF1776 3HCDH_N IMPDH NmrA
Motif
Other DBs
NCBI-ProteinID: AZG15676
UniProt: A0A3G8H5J4
Position
2:327458..328234
Genome map
AA seq 258 aa AA seqDB search
MQLQGKTALVTGGAGGIGRAIALRLAREGADVVVAVHRHDADADETADGVRAAGRRAHVV
AGDIGNVAQAFALVDAAVQAVAPSGSLDILVNNAGVEVRAPFADVTEADYDRVLDTNLKG
PFFLTQRFVRHRLDRKLGGKVINISSVHEDLPFPHFTSYCASKGGLRMMMRNLAIELAPA
GITVNNIAPGAIQTPINRKLMASPDQLQSLLTNIPLGRLGQPEEVAGLVAYLASADADYI
TGATLVIDGGLLWNYAEQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgcaaggcaagacagcgctggtcacgggcggcgcgggcggtatcggcagggcc
attgcgctgcggctggcgcgcgagggggcggacgtggtggtggcggtgcaccggcatgac
gccgatgccgacgagaccgccgacggcgtgcgcgccgccgggcgccgcgcccacgtggtg
gccggcgacatcggcaacgtggcgcaggcgtttgcgctggtcgacgctgccgtgcaggcg
gtggccccgtcgggcagcctcgacatcctcgtcaacaacgccggcgtggaggtgcgcgcg
ccgtttgccgacgtgaccgaggccgactacgaccgcgtgctcgacaccaacctcaagggc
ccgttcttcctgacccagcgcttcgtcaggcaccggctggaccgcaagctgggcggcaag
gtcatcaacatcagctcggtgcacgaggacctgccgttcccgcatttcacaagctactgc
gccagcaagggcggcctgcggatgatgatgcgcaaccttgccatcgaactggcgccggct
ggcatcaccgtcaacaacatcgcgcccggcgcgatccagacgccgatcaaccgcaagctg
atggccagccccgaccagttgcagtctctgctgaccaatatcccgctgggccggctgggc
cagcccgaggaagtggccgggctggtggcctacctggccagcgccgacgcggactacatc
acgggcgccacgctcgtcatcgatggcggactcctctggaactatgcggaacaatga

DBGET integrated database retrieval system