KEGG   Cupriavidus pauculus: EHF44_19750Help
Entry
EHF44_19750       CDS       T05738                                 

Definition
(GenBank) gamma-glutamyltransferase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00430  Taurine and hypotaurine metabolism
cpau00460  Cyanoamino acid metabolism
cpau00480  Glutathione metabolism
cpau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EHF44_19750
   00460 Cyanoamino acid metabolism
    EHF44_19750
   00480 Glutathione metabolism
    EHF44_19750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cpau01002]
    EHF44_19750
Enzymes [BR:cpau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     EHF44_19750
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     EHF44_19750
Peptidases and inhibitors [BR:cpau01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   EHF44_19750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AZG15701
UniProt: A0A3G8H597
Position
2:complement(354537..356366)
Genome map
AA seq 609 aa AA seqDB search
MFTTRPEIVGTFGVAASTHWLATQTAMGVLERGGNAFDAAVAAGFVLQVVEPHLNGPGGE
VPILFWSEKDRAVRAVCGQGPAPALADPEALRRQGMELMPGIGLMPATVPGAFGAWLTML
RDHGTWSVADVLAPAIGYARNGFPLVPRISQAILAVESLFRDEWHSSADTWLPDGKVPRP
GALHTLPVLADTYTRVVETAMAASDSRTGQIDAAMQCWYRGFVAEAIDAYCRDTPVRDTT
GEKHTGLLRYDDLAGWTPTVEAPVSLDFGRYAVAKCDIWSQGPMFLQQLGMLRHAGLDAH
APTSPEFVHKIAEAAKLAMADRTAWYGDPLFTDSRLRALLDPQYLAARAALIGDQASTAM
LPGALGGLAPRMPDLGVAERTLAVADTRFGIGEPTFAALPPVSEWAEREVFVGDTCHIDV
IDRHGNMVAATPSGGWLSSSPTIPSLGFALNTRLQMTWLEPGLPNTLAPGKRPCTTLSPS
LCLRDGEPYMVFGTPGGDQQDQWSLAFFMRHAVHGMNLQEAIDAPAWHIDHFPQSFWPRQ
TTLNRITVESRFPAATVDALRARGHEVRVGEDWSEGRMSACTRERDARGRLVLRAGANAR
GMQGYAVGR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgacacgccccgagatcgtcggcaccttcggcgtcgccgcttccacccactgg
ctggccacgcagacggcgatgggcgtgctggaacgcggcggcaatgccttcgacgcggcg
gtggcggcgggcttcgtgctgcaggtggtggagccgcacctgaacggccccggcggcgag
gtgccgatcctgttctggagcgaaaaggaccgcgccgtgcgcgcggtctgcggccagggc
ccggccccggcgctggcggaccccgaggcactgcgccgccagggcatggaactgatgccc
ggcatcggcctgatgcccgccacggtgcccggcgcgttcggcgcatggctgacgatgctg
cgcgaccacggcacgtggtcggtggccgacgtgctggcgcccgccatcggctacgcgcgc
aacggctttccgctggtgccgcgtatctcgcaggccatcctggccgtcgagtcgctgttc
cgcgacgaatggcacagctcggccgatacctggctgcccgacggcaaggtgccgcgcccc
ggcgcgctgcacacgctgccggtgctggccgatacctacacgcgcgtggtggagaccgcc
atggccgccagcgacagccgcaccggccagatcgacgccgcgatgcagtgctggtaccgc
ggcttcgtggccgaagccatcgacgcctactgccgcgacacccccgtgcgcgacaccacg
ggcgaaaagcacaccggcctgctgcgctacgacgacctggcgggctggacgcccacggtc
gaggcgccggtctcgctggacttcggccgctacgcggtggccaagtgcgacatctggagc
caggggccgatgttcctgcagcagcttggcatgctgcgccacgctgggctggacgcccac
gcgcccacgtcgcccgaattcgtgcacaagattgccgaggccgccaagctggcgatggcc
gaccgcaccgcgtggtacggcgatccgctgttcaccgacagccgcctgcgcgcgctgctg
gacccgcagtacctggccgcgcgcgccgcgctgatcggcgaccaagcgtcgacggcgatg
ctgcccggcgcgctgggcggcctggcgccgcgcatgccggaccttggcgtggccgagcgc
acgctggccgtggccgacacgcgcttcggcatcggcgagcccacgtttgccgcgctgccg
ccggtcagcgaatgggccgagcgcgaggtctttgtcggcgatacctgccatatcgacgtg
atcgaccgccacggcaacatggtggcggccacgccgtcgggcggctggctgtcgtcgagc
ccgaccatcccgtcgctgggtttcgcgctgaacacgcggctgcagatgacgtggctggaa
ccggggctacccaacacgctggcaccgggcaagcgcccgtgcaccacgttgtcgccgtcg
ctgtgcctgcgcgacggcgagccgtacatggtcttcggcacgcccggcggcgaccagcag
gaccagtggtcgctggcgttcttcatgcgccacgcggtgcacggcatgaacctgcaggag
gcgatcgacgcgcccgcgtggcatatcgaccatttcccgcagtcgttctggccgcgccag
acgacgctgaaccgcattaccgtcgaatcgcgcttcccggctgccaccgtggacgcgcta
cgcgcgcgcgggcacgaagttcgcgtgggtgaagactggtcggaaggccgcatgtcggcc
tgcacgcgcgagcgcgacgcgcgcggccggctggtgctgcgcgccggcgccaacgcgcgc
ggcatgcagggttacgcagtgggccgctaa

DBGET integrated database retrieval system