KEGG   Cupriavidus pauculus: EHF44_24685Help
Entry
EHF44_24685       CDS       T05738                                 

Definition
(GenBank) oxygen-insensitive NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00633  Nitrotoluene degradation
cpau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    EHF44_24685
Enzymes [BR:cpau01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     EHF44_24685
  1.-  
   1.-.-  
    1.-.-.-  
     EHF44_24685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase DUF3483
Motif
Other DBs
NCBI-ProteinID: AZG16576
UniProt: A0A3G8H7X9
Position
2:1470139..1470792
Genome map
AA seq 217 aa AA seqDB search
MQVKDAILSRHTVKAYEAGQTLPQEQVDTLLTWLHNSPSSVNSQPWHFVVASTPEGRDTI
AQAATGTFAYNHPKIVDASHVIALCMRTDLDEAHLRAVLAQEEADGRFRAEGAREGQDKS
RRSYVDLHRYVQRDMPQWMEKQVYLALGGLLLGAAMLGIDATPMEGFDGAALDQALKLRE
RGLTGVVLVALGRRSEKDFNAGLPKSRLPRETVFTHI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaaggacgccatcctgtcccgccataccgtcaaggcgtacgaagccggccag
acgctgccgcaagagcaggtcgacacgctgctgacgtggctgcacaacagcccgtcgtcg
gtcaattcgcagccctggcactttgtcgtggcgtcgacgccggaaggccgcgacaccatc
gcccaggccgccacgggcacgtttgcctacaaccatccgaagatcgtcgatgcgtcgcac
gtgatcgcgctgtgcatgcggaccgatctggacgaggcgcacctgcgcgccgtgctggcg
caggaagaggccgacggccgctttcgcgccgagggtgcgcgcgaaggccaggacaagtcg
cgccggtcgtacgtcgacctgcaccgctacgtgcagcgcgacatgccgcaatggatggaa
aagcaggtctacctggcgctgggcgggctgctgctgggcgccgccatgctcgggatcgac
gccacgccgatggaaggctttgacggcgcggcgctggaccaggcgctgaagctgcgcgag
cggggcctgaccggcgtggtgctggtggcgctgggccgccgcagcgagaaggacttcaac
gccggcctgccgaagtcgcggctgccgcgcgaaacggtgttcacgcacatctga

DBGET integrated database retrieval system