KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0535Help
Entry
Cphamn1_0535      CDS       T00709                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01130  Biosynthesis of antibiotics
cpb01230  Biosynthesis of amino acids
Module
cpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphamn1_0535
Enzymes [BR:cpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cphamn1_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACE03498
UniProt: B3EMC0
Position
563812..564588
Genome map
AA seq 258 aa AA seqDB search
MTTYLTKILDYKSSEVDQLKQQDPASRYRDAASDLMPARDFAGALKNDQGSVKLIAEVKK
ASPSRGVMVEDFNPLDIARRYAGIGASAFSVLTDRHFFQGSNQYLQQVSASFDLPVLRKD
FIIDESQIYEARLIGADAILLIVAALDTFRLKDYLQLAAGIGLGVLVEVHDRSELDCALD
AGATVVGVNNRNLKDFSVSLDTSLLLRPAIPDDVISVAESGLKKISDVSLMQDASFDAVL
IGEGLLSSELQQFTWTRT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactacctatctgacaaaaatactggactataagtcttccgaggtagatcagcttaaa
cagcaggatcctgcatcccggtaccgtgacgcagcgtcggatctgatgccggcaagagat
tttgccggagccttgaaaaatgatcagggttctgtaaagctcatcgcggaagttaagaag
gcctctccgtcaagaggggttatggtggaggatttcaatccgcttgacatcgcgcgtcgt
tatgcagggataggggcttccgcgttttccgttcttaccgacaggcatttttttcagggt
tctaatcaatacctgcagcaggtgagtgcttcttttgatcttcctgtgttacgcaaggat
tttattatcgatgaatcacagatatacgaagcacgcctgataggtgccgatgctatcctg
cttatagtcgcagcgcttgacactttccggctcaaagactatttgcagcttgcggccgga
attggcttaggcgttcttgttgaagtgcatgacaggtctgaactggattgtgccttggac
gcgggagcgacagttgtcggagtcaataaccggaacctgaaggacttcagcgtttcgctc
gatacctcgcttcttctcaggcccgcaatacccgatgacgtgatctcggttgcggaaagc
ggcttgaaaaagatttccgatgtatccctgatgcaggacgcgtcgtttgacgctgtcctg
atcggagaaggattgctgagctctgaactgcagcagtttacctggacgcggacttga

DBGET integrated database retrieval system