KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0608Help
Entry
Cphamn1_0608      CDS       T00709                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00010  Glycolysis / Gluconeogenesis
cpb00030  Pentose phosphate pathway
cpb00051  Fructose and mannose metabolism
cpb00052  Galactose metabolism
cpb00680  Methane metabolism
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01120  Microbial metabolism in diverse environments
cpb01130  Biosynthesis of antibiotics
cpb01200  Carbon metabolism
cpb01230  Biosynthesis of amino acids
cpb03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_0608
   00030 Pentose phosphate pathway
    Cphamn1_0608
   00051 Fructose and mannose metabolism
    Cphamn1_0608
   00052 Galactose metabolism
    Cphamn1_0608
  Energy metabolism
   00680 Methane metabolism
    Cphamn1_0608
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cphamn1_0608
Enzymes [BR:cpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cphamn1_0608
Protein phosphatases and associated proteins [BR:cpb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cphamn1_0608
Messenger RNA biogenesis [BR:cpb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cphamn1_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Glyco_hydro_49
Motif
Other DBs
NCBI-ProteinID: ACE03567
UniProt: B3EMT9
Position
complement(640519..641724)
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVIKGAAFMALSKGIELYVIPNGYAGLYNLIDQETLVRLDRAR
LDQFPGNFAGSEAGHSRVKIKAISNPEKYHRIKEGMSKFELDGLVISGGDDSGSVMVDLS
NNGIQCIHAPKTMDLDLQTYSVGGDSTINRIAQFVQDLKTTGKTHNRILVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPADWDIVYEHIVGRFTGRIRQSDVRSGTYTIVVAEGLKNAD
GTDIVDESAGVDAFGHKKLAGAGKYVCQELKKRLKADPDMPVFMKETGMFVEGIYEIPEI
REIHPGHLVRCGNSSAYDINFGYEAGAAAVILLLEGRSGVTISKVKGRKIEFIESSKAIE
QRHVDLDQVALYESLGVCFGREIMTYNPILREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcattttgaccagtggcggagattgcggcggcctgaatgccgtcatc
aagggagccgcatttatggctttgtcgaaaggaattgagttatacgtcattccgaatggt
tatgcagggttgtacaaccttatagatcaggagacgcttgtacgacttgacagggcacgt
ctggaccagtttcccggcaacttcgcgggatccgaggcggggcattcgcgcgttaaaata
aaagctatcagcaaccctgagaaataccaccgtatcaaggaaggaatgagtaagttcgaa
cttgacggcctggttatcagcggtggagacgacagcggcagcgtcatggttgatttgagc
aataacggtattcagtgtattcatgcgccgaaaaccatggatctcgacctgcagacatac
tctgtcggaggcgattcaaccatcaacagaatcgcacagttcgttcaggatctgaaaaca
acgggaaaaacgcataaccgcattctcgtcacggaggtattcggaagatatgcaggtcat
accgccttcagaagcggcgtcgcagcagaggcggattgtatactcattcctgaaataccc
gcagactgggatatcgtctatgagcatattgtcggacgcttcaccggccgcatcaggcag
agcgacgttcgttccggaacctatacaattgttgtcgccgaaggccttaaaaacgccgat
ggaaccgatatagtcgatgaatctgcgggagttgacgcattcgggcacaaaaaacttgcc
ggtgcaggcaagtatgtctgtcaggagttgaagaaaagactgaaagccgatccggatatg
ccggtattcatgaaggaaacaggaatgtttgttgaagggatctatgagattccggaaatc
agggagatccatccgggacaccttgtgcgttgcggaaactcctctgcatatgatatcaac
ttcggctatgaagccggagcggcagccgtaatactgcttttggaaggcagatcaggtgtc
accatttcaaaagtgaaaggccggaaaattgaattcattgaatcaagcaaggctattgaa
caacgccatgtcgaccttgaccaggtcgcgctctatgaatcactcggtgtctgcttcggg
cgggaaatcatgacctataatccgatcctgagagaagttgacggtgtctatgaaagaatt
tattga

DBGET integrated database retrieval system