KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1989Help
Entry
Cphamn1_1989      CDS       T00709                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00860  Porphyrin and chlorophyll metabolism
cpb00970  Aminoacyl-tRNA biosynthesis
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01120  Microbial metabolism in diverse environments
Module
cpb_M00121  Heme biosynthesis, glutamate => heme
cpb_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
cpb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_1989
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cphamn1_1989
Enzymes [BR:cpb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Cphamn1_1989
Amino acid related enzymes [BR:cpb01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Cphamn1_1989
Transfer RNA biogenesis [BR:cpb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cphamn1_1989
 Prokaryotic Type
   Other AARSs
    Cphamn1_1989
Prokaryotic defense system [BR:cpb02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Cphamn1_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ACE04900
UniProt: B3EMG1
Position
complement(2137541..2139052)
Genome map
AA seq 503 aa AA seqDB search
MQATPGQRVRTRFAPSPTGHLHVGGLRTALYNYLYAKSMGGDFIVRIEDTDQARKVEGAE
RSLLNTLEVTGIVPDESFIHGGNFGPYVQSERLGIYSKYCEQLLEQKQAYYCFSTAEELE
ANRKLQMKQGMQPKYDRKWLPEEMGGNMPESEIRRKREEGAPFVVRMKVPDYISIMFEDM
IRGPIEFDSATVDDQVLMKSDGFPTYHFASIIDDHLMEISHVIRGEEWLSSMPKHILLYE
FFGWEPPKVAHLPLLLNPDRSKLSKRQGDVAAEDFISKGYSPEAIINFVALLGWNEGEGC
EREVYSLDELKDKFTLRRVGKAGAVFNVEKLGWLEKQYIKARPASEIISAIKPLLQAELA
KKETGMDADRLVSDDYLGQVIELMRERVNFEHEFISFSRYFYFDPEEFDEKAVAKRWVDD
TNEVLGEFIEVLENTADFSADNIEAALKAFVAPREKKPAFLIHPVRILTSGVGFGPSLYH
MLEVLGKETVIRRLRKGIGVVGK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaactccaggtcagcgggtaagaacgagatttgctccatcgcctacgggacac
ctccatgtcggagggttgcgtacagccctctataattatctctacgcgaaaagtatgggc
ggtgactttatcgtcaggatcgaggataccgatcaggcgagaaaagttgagggagcagaa
cgaagtttgctgaacacgcttgaagtgacgggtattgtccctgacgaaagcttcatacac
ggtggtaatttcggcccgtatgtccagtccgaaaggcttggtatctatagcaaatactgt
gagcagctgcttgagcaaaagcaggcctactactgtttctccaccgctgaagaacttgag
gcaaaccgcaagcttcagatgaaacagggtatgcagccgaagtacgatcggaaatggctt
cccgaagagatgggcgggaatatgccggaaagtgaaatcaggagaaaacgtgaagagggt
gctccgttcgttgttcgaatgaaagtgcccgactacatttccatcatgttcgaggatatg
atacgcggtcctatcgagtttgattcggctacggtagacgatcaggtgctgatgaaatca
gacggttttccgacctatcatttcgccagtatcatcgatgatcatctcatggagatcagt
catgtcattcgcggtgaagagtggctttcatccatgccgaagcatatcctgctgtatgaa
tttttcggatgggagccgcccaaagtggctcatctccccctgcttctcaatcctgaccgc
tcaaaactcagcaaacgtcagggggatgttgcagctgaggactttatcagcaagggttac
agtccggaggccatcatcaactttgtcgctcttctcggctggaatgaaggtgagggttgc
gaaagagaggtgtacagccttgatgaactcaaggataagttcactcttcgcagagtcgga
aaagccggagcggtgttcaatgtggaaaaactcggctggcttgaaaagcagtatataaag
gctcgtccggccagtgaaattatcagcgcgatcaagccgcttctgcaggcggagcttgca
aagaaagaaaccggcatggatgccgatcgtcttgtcagtgacgactatctcgggcaggtg
attgaactgatgcgtgaacgggtgaatttcgaacatgagttcatctctttttcccgttac
ttctatttcgatccggaagaattcgatgaaaaagccgttgcgaaacgctgggttgacgat
accaatgaagttctgggagagtttatcgaggtgcttgaaaataccgctgatttcagcgcg
gacaacatcgaggccgccctcaaggcttttgtggcacctcgcgaaaagaaaccggcattc
ctgattcaccccgtgaggattcttacctcaggcgtaggattcggccctagcctctatcat
atgcttgaagtactcggaaaagaaaccgtcatccgaaggctcaggaaagggatcggggtg
gtggggaagtga

DBGET integrated database retrieval system