KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2015Help
Entry
Cphamn1_2015      CDS       T00709                                 

Definition
(GenBank) ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb03010  Ribosome
Module
cpb_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cpb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Cphamn1_2015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpb03011]
    Cphamn1_2015
Ribosome [BR:cpb03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Cphamn1_2015
  Bacteria
    Cphamn1_2015
  Archaea
    Cphamn1_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13 DUF3659
Motif
Other DBs
NCBI-ProteinID: ACE04925
UniProt: B3EMI6
Position
complement(2167837..2168289)
Genome map
AA seq 150 aa AA seqDB search
MSKTISFKTYSAKPGEVERKWYVVDAEGKVLGRLASEIATILRGKHKPQFTPHVDTGDFV
IVTNAGKIGLSGKKLDQKTYFSHSNYPGGVKIENLKDMLRKKPEKVIEKAVWGMLPHNNL
GRALFKKLKVYAGPEHPHVSQSPVEMKVNQ
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagacgataagtttcaagacatattcggcaaaaccaggtgaagtggaacgaaaa
tggtatgtcgttgacgcagaaggcaaagtgctgggccgtcttgccagtgagatcgcgacg
attctgcgcggaaaacacaaaccgcagttcacaccccatgtcgatacgggtgatttcgtt
attgtgacaaacgccggtaaaatcggtttgagcggcaagaagctggatcagaaaacctat
ttctcccattcaaattatcccggcggcgtgaaaatagagaacctcaaggacatgctccgg
aaaaaacctgaaaaggttatcgagaaagctgtatggggtatgttgccgcacaataatctc
gggagagcgcttttcaagaaactcaaggtctacgcaggtccggagcatccgcatgtgtct
cagagtcctgttgaaatgaaggttaaccaataa

DBGET integrated database retrieval system