KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2111
Entry
Cphamn1_2111      CDS       T00709                                 
Name
(GenBank) Enoyl-CoA hydratase/isomerase
Organism
cpb  Chlorobium phaeobacteroides BS1
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ACE05020
UniProt: B3EN31
Position
2287112..2287909
AA seq 265 aa
MPDKQHTSETVLIKKDEHEIGHITINRPKAYNALSIECMEALIRALDILSADSSVRVIIL
AGSGKGFCAGHDLKELRSCTEKTFHKKIFDLCTRLMLSITRSPKPVIAKVHGIATAAGCQ
LVASCDLAVAEKNAGFATPGVTIGLFCSTPMVALSRNISKKHAMEMLLSGDLISAQRAYE
TGLINRLVPIEQLDQATLDLAKKIASKSPLALKIGKRAFYEQLDRNEEDAYRYCSQVMVE
NLTSRDAKEGIDAVLEKRSPVWCGE
NT seq 798 nt   +upstreamnt  +downstreamnt
atgccagataaacaacacacctctgaaacagtacttatcaaaaaagatgagcatgaaatt
ggtcacatcaccatcaacaggccaaaagcctacaatgcattgtccatcgaatgcatggaa
gctttgatccgggcattggatatcctgtctgctgattccagtgtcagggttatcattctt
gctggatcaggaaaagggttttgcgccggccatgatttaaaagaattacgaagctgcacg
gaaaaaacgtttcataaaaagatttttgacctttgcaccagattgatgttatcaattact
cgttcacccaagccggttatcgccaaagtccatggcattgctactgctgcaggctgccag
cttgtcgcgagctgtgatcttgctgttgcagaaaaaaatgccggattcgctacaccagga
gttactatcggcttgttttgttctacgcctatggtagcattatctcgaaatatttcgaaa
aagcatgcgatggaaatgttattgtcgggagatctgatctcggcccagcgggcctatgaa
acaggactcatcaaccggctggtgcccatcgaacaacttgaccaggcaacacttgatctt
gcgaaaaaaatagcctcgaaatcacccctcgccctcaagatcggcaaacgagcattttat
gagcagcttgacaggaatgaagaggacgcatatcggtactgcagtcaggtgatggttgag
aatctgacgagccgggatgcaaaagaagggatcgatgccgttttggaaaaacgctctccc
gtttggtgtggcgaataa

DBGET integrated database retrieval system