KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_2258Help
Entry
Cphamn1_2258      CDS       T00709                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00860  Porphyrin and chlorophyll metabolism
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_2258
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Cphamn1_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ParA ArsA_ATPase MipZ AAA_16 AAA_24 AAA_26 MeaB SRP54 NB-ARC CBP_BcsQ AAA_25 RNA_helicase DUF87
Motif
Other DBs
NCBI-ProteinID: ACE05162
UniProt: B3ENS3
Position
complement(2441756..2442583)
Genome map
AA seq 275 aa AA seqDB search
MSLILAVYGKGGIGKSTTTANISAALALKGAKVLQIGCDPKHDSTFPLTGTLQKTVIEAL
EEVDFHHEELTEEDIILTGFGGVDALEAGGPPAGSGCGGYVVGEAVKLLQELGVYDRYDV
ILFDVLGDVVCGGFSAPLNFADYAVIIATNDFDSIFAANRLCMAIEQKSTRYKVKLAGIV
ANRVDYVKGGGTNMLEQFSDKVGTKLLARVPYHELIRKSRFAGKTMFQMEDGPEKEECVK
PYNEIADFLLSRNPTSSVPVPIGDRDIFEIVGGWQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaattcttgctgtttatggaaagggaggtataggaaagagtacaactaccgcg
aatatttcagcggcacttgccttgaaaggcgctaaagtgttgcagataggctgtgatccc
aaacacgacagtacctttcctctcaccggtacactgcagaaaaccgttatagaagcgctt
gaagaggttgattttcatcacgaagaactcactgaagaagacattattcttaccggattt
ggtggtgttgacgcccttgaggctggcggccctccggcaggaagcggatgtggcggctat
gtcgtcggcgaggcagtgaagcttctgcaggagcttggcgtctacgaccgttacgacgtc
attcttttcgacgtgcttggtgatgtcgtgtgcggtggattcagcgccccgttgaatttt
gcggactatgctgtgattatcgcaaccaatgattttgacagcatcttcgctgcaaaccgt
ctctgtatggctatagagcagaagagcacgcgttacaaggtgaaactcgccggtattgtc
gccaaccgtgttgactatgtcaagggtggaggcacgaacatgctcgagcagttttcagac
aaggtcgggaccaagcttcttgcacgggttccctaccatgaactgatccgcaaaagccgt
ttcgccggaaagaccatgttccagatggaagacggccctgaaaaggaggaatgcgtcaaa
ccctacaacgagatcgcagactttctgctttcccggaacccaacgtcatcagttcccgtc
cctatcggcgacagggatattttcgagattgtcggagggtggcagtag

DBGET integrated database retrieval system