KEGG   Chlorobaculum parvum: Cpar_0039Help
Entry
Cpar_0039         CDS       T00725                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00860  Porphyrin and chlorophyll metabolism
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
cpc01120  Microbial metabolism in diverse environments
Module
cpc_M00121  Heme biosynthesis, glutamate => heme
cpc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpar_0039
Enzymes [BR:cpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Cpar_0039
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cpar_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ACF10467
UniProt: B3QRF6
Position
44314..45693
Genome map
AA seq 459 aa AA seqDB search
MTDRTPAEQAPRKGYVYIAGAGPGDPELMTIKADRALREADVILFDDLVLPQMLEAYKAE
KIYTGKRKDAHHFAQDEINQEIVRHALLGKTVVRLKGGDPFIFGRGGEEIETLRQHGIDY
EIIPGITAAHGASAYSEIPLTMRKVSSSVAFCTGHPVNKIQVPDTDTIVYYMVASNVHDV
LDKVAASGRSGETMVAVVQNATRYNQRVFTGTLDEFRKRERAVYSPALLIIGQNINQYIE
QTWYSRKKKVLMTGGDVKKYDPANWITVHFPCRQVAGADLDAVKRCMGKIDDFSMLFFQN
RFAVTYFFKYLFEHGKDVRHLAHMTICTSSRTAASELLEYGIIPDCCLESEGSSTISGLL
GKEGLTGQNILLPGAENVDEAVSAELKSAGNSVTPLTVYVHGAQDKGDAIDLDFIDEIYF
ASPACVRKFRELYGEIPARITVAPADANTREEYSRLFGA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatagaactccagcggagcaggctccgcgaaaaggctacgtttatatcgctggc
gcggggccgggcgatcccgagctgatgaccatcaaggccgaccgggcgcttcgcgaggcg
gacgtgattctgttcgacgatctggtgcttccgcagatgctcgaagcctacaaggccgag
aagatctataccggcaagcgcaaggatgcgcaccacttcgcgcaggacgaaatcaaccag
gagatcgtgcgccacgcgctgctcggcaagacggtggtgcggctcaagggcggcgatccg
ttcatcttcgggcgcggcggcgaggagatcgagacgctccggcagcacggcatcgactac
gaaatcatccccggcatcactgccgcgcacggggcgagcgcgtacagcgaaattccgctc
accatgcgcaaggtctcctcgtcggtggccttctgtaccggccatccggtcaacaagatt
caggtgcccgatacagatacgatcgtctattacatggtggcctcgaacgtgcacgacgtg
ctcgacaaggtggccgcgtcaggccgcagcggtgagacgatggtggctgtggtgcagaac
gccacccgctacaaccagcgcgtcttcaccggtacgctcgacgagttccgcaagcgcgag
cgggcggtctattcaccggcgctgctcatcatcggccagaacatcaaccagtacatcgaa
cagacctggtattcgcgcaagaagaaggtgctgatgaccggcggcgacgtcaaaaagtac
gacccggcaaactggatcacggtgcacttcccgtgccgtcaggtggctggggccgacctc
gacgcggtgaagcgctgcatgggcaagatcgacgacttctcgatgctctttttccagaac
cgtttcgccgtcacctactttttcaagtacctcttcgagcacggcaaggatgtgcgccac
ctggctcacatgaccatctgtacctccagccgcacggcggccagcgagctgctcgaatac
ggtatcattcccgattgctgcctcgaatcggaggggtcatcgaccatttccggactactt
ggcaaggaggggctcaccggccagaacattctcctgcccggtgcagagaacgtcgatgag
gccgtttctgccgaactgaagtctgcgggcaacagcgtcacgccgctgaccgtctatgtg
cacggtgcgcaggacaagggtgatgcgatcgacctcgatttcatcgacgaaatctatttc
gcctccccggcttgcgtccggaaattccgcgaactgtacggcgagattccggcccgtatc
acggtcgctcctgccgatgccaacacgagagaggagtattccagactgttcggcgcctga

DBGET integrated database retrieval system