KEGG   Chlorobaculum parvum: Cpar_0726Help
Entry
Cpar_0726         CDS       T00725                                 

Definition
(GenBank) magnesium chelatase ATPase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00860  Porphyrin and chlorophyll metabolism
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpar_0726
Enzymes [BR:cpc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cpar_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM Sigma54_activat DUF1676 VWA_CoxE
Motif
Other DBs
NCBI-ProteinID: ACF11145
UniProt: O50313
Position
778704..780563
Genome map
AA seq 619 aa AA seqDB search
MIAFTDIVGMDLAKQALMLLAVDPSLGGVVIPSTVGSGKSTLARAFADILPEGTPFVELP
LNVTEDRLIGGVDLEATLASGQRVVQHGVLSKAHKGVLYVDSLSLLDSSAVSHIMDAMSR
GAVIVEREGLSEVHPADFMLVGTYDPSDGEVRMGLLDRIGIIVPFTPVNDYRARKQIVSL
VMGTRNEEDTQDELRMLRGIIGAAREQLHHVSITNEQIKGLIQTAISLGVEGNRVDIFAI
RAALANAALGQRTEVDDEDLKLAVKLVLVPRATRMPEREPSEEEMQQEEPPPPEEQPEQE
GEDENAPPDETDSDADEEQEETPDMIEELMMDAIETDLPENILNISLASKKKAKSGSRGE
ALNNKRGRFVRSQPGEIKSGKVALIPTLISAAPWQAARKAEKAKKGIKTGALVISTDDVK
IKRFRDKSGTLFIFMVDASGSMALNRMRQAKGAVASLLQNAYVHRDQVSLISFRGKQAQV
LLPPSQSVDRAKRELDVLPTGGGTPLASALLTGWETAKQARTKGITQIMFVMITDGRGNI
PLAAAVDPAAAKAPKEELEKEVEALALSIQSDGIASIVVDTQMNYLSRGEAPKLAQKLGG
RYFYLPNAKAEQIVEAALS
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatagcatttaccgacattgtaggaatggatctggccaagcaggcgctgatgctcttg
gccgtcgatccctcccttggcggtgttgtgattccttcaaccgtaggttctggaaaatcg
acgctcgcaagggcattcgccgatattctgcctgaaggcactcccttcgtggagctgccg
ctgaacgtgaccgaagaccgtcttatcggcggtgtcgatcttgaagcgacccttgcctcc
ggccagcgcgtcgtgcagcacggcgtgctttccaaagcacataagggtgtgctttacgtc
gattcactcagcctgctcgacagctccgctgtgtcgcacatcatggatgccatgagccgc
ggcgcggtgatcgtcgaacgcgagggcctcagcgaggtgcatccggctgacttcatgctg
gtcggcacctatgacccgagtgacggtgaggtgcgcatgggcctgctcgaccgcatcggc
atcatcgtgccgttcacccctgtcaacgactatcgcgcccgcaagcagatcgtcagcctc
gtgatgggcacgcgtaacgaagaggatacgcaggatgaactgcgcatgcttcgcggcatc
atcggcgccgcaagggagcagttgcaccacgtctcgattaccaacgagcagatcaagggg
ctcattcagacagccatcagcctcggcgtcgagggcaaccgcgtcgatatcttcgcgatt
cgcgccgcccttgccaacgccgcgctcggtcagcgcaccgaagtggacgacgaggacctc
aagcttgccgtcaagcttgtgcttgtgcctcgcgctacccgcatgcccgagcgcgagccc
agcgaggaggagatgcagcaggaagagccgccaccgccagaggagcagcccgaacaggag
ggggaagacgaaaacgcaccaccagacgagaccgattccgatgccgacgaggagcaggag
gagactcccgacatgatcgaggagctgatgatggacgctatcgagaccgatcttcccgag
aacattctcaacatctcgctcgcatccaaaaagaaggccaagtccggaagccgtggcgaa
gcgctgaacaacaagcgcggtcgctttgtgcgctcgcagcccggcgagatcaagagcggc
aaggtcgcgctcatcccgacgctcatctctgccgcaccttggcaggcagcgcgaaaggcc
gagaaggctaaaaaaggcatcaagaccggcgcgctggtcatcagcacggacgatgtcaag
atcaagcgtttccgcgacaagtccggcacgctgttcatcttcatggtggatgcctccggc
tcgatggcgctgaaccgcatgcgccaggccaagggcgcggtggcgagcctgttgcagaac
gcctacgtgcatcgcgaccaggtctcgttgatctcgttccgcggcaagcaggcgcaggtg
ctcctgccaccatcgcagagcgtggatcgcgccaagcgtgagcttgacgtgctgcctacc
ggcggcggaactccgctcgcctcggcgctgctcaccggctgggaaaccgccaagcaggcg
cgcaccaaggggatcacgcagatcatgttcgtcatgattaccgacggtcgcggtaacatt
ccgctggccgccgcagtcgatcccgccgccgccaaagcgcccaaagaggagctggagaaa
gaggtggaagcactggccctctcaatccagagcgacggcatcgcctctatcgtggtcgat
acccagatgaactacctctcacgcggcgaagcccccaagctcgcccagaaactcggtggc
cgctacttctaccttcccaacgccaaagccgaacagatcgtcgaagcagccctgagctga

DBGET integrated database retrieval system