KEGG   Chlorobaculum parvum: Cpar_0761Help
Entry
Cpar_0761         CDS       T00725                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpar_0761
Enzymes [BR:cpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cpar_0761
DNA repair and recombination proteins [BR:cpc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cpar_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 PhoH NTPase_1 Helicase_RecD PIF1 AAA_29 AAA_16 AAA_5 NACHT RsgA_GTPase HHH T2SSE AAA_23 AAA AAA_22 UvrD_C ABC_tran cobW AAA_28 ArgK DUF2075 SRP54 MobB AAA_18
Motif
Other DBs
NCBI-ProteinID: ACF11178
UniProt: B3QMM5
Position
complement(817993..820194)
Genome map
AA seq 733 aa AA seqDB search
MTTPADTHEERLSGSVERVTFHSEESGFTVLRLRVAGQREPVAVVGLAASPAVGEFMECV
GTWQNDRTHGLQFKATKITPVQPTTLEGKERYLASGQVKGLGNYYAKKLIEQFGDAVFDV
IENEPERLLEVPGIGRKRLDMVIESWTEQRAIRDIMLFLQEHGVGAARAWKIYRRYREGA
IATITENPYRLSLDIEGIGFQTADTIAASLGVERNSLMRAEAGITHVLGQMSSDGHCAVP
EETLIGEASRLLEIDRPLVAEAVTNEKLTRRIVGETIDEVPCIFLESLHRAETGVASALH
RLKRGPLPWEPLDPHDVLPWIEEQTGLELSPSQRSAVTLVLASKVSIITGGPGVGKTTIL
KAILSVLQREKVSVALCAPTGRAAKRLTESTGIEAKTIHRLLEFDPQIFDFKRGRGNPLD
VSFVVVDETSMVDVVLMQKLVAAIPDRAAVVFVGDVDQLPSVGPGAVLADLIASEVIPTV
CLTEIFRQAAESMIVVNAHRINQGEMPLTDEGEELSDFYIVPASSPEAIHDKVMQLVTER
IPKRFDLDPVRDVQVLTPMNKGGIGVQALNAELQARLNPTAEPKVTRFGSTFAPGDKVIQ
TVNNYDKEVFNGDIGLIEQIDTDAETLTALFDHHHVEYDFSDLDELSLAYAISIHKSQGS
EYPAVVIPLSMQHYPLLERNLAYTAVTRGRKLVVIVAEPKALDRAIRNCKSKRRLTGLVQ
RLKESGKQSWQNL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacccgccgacacccatgaagagcgcctctcgggttccgtcgagcgggtaacg
tttcacagcgaggaatctggcttcacggtgctgcgcctgcgggttgccgggcagcgcgag
ccggtggcggtggtcggcctcgctgcctcgcctgccgtgggcgagttcatggagtgcgtt
ggcacgtggcagaacgaccgcacgcacggcttgcagttcaaggcgacgaaaataaccccc
gtacagcccaccacgctcgaaggcaaggagcgctacctcgcatcggggcaggtgaaggga
cttggcaactattacgcaaaaaagctgatcgagcagtttggcgacgcggtgttcgatgtg
atcgaaaacgaaccggagcgactactcgaagtgccaggcatcggacgcaagcggctcgac
atggtgatcgaatcgtggactgagcagagagccatacgggacatcatgctctttctgcag
gagcacggcgtcggcgcagcaagggcctggaaaatctaccgccgctaccgcgaaggggcc
atcgccaccatcacggaaaatccctaccgcctctcgctcgacatcgaaggcatcggcttc
cagacggccgacaccatcgctgcgagccttggcgtcgaacggaactcgctcatgcgggcc
gaagcgggcatcacccatgtgctcggccagatgtcgagcgacggccactgcgccgttccg
gaagagacgctcatcggcgaagcctcacgcctgctcgaaatcgaccgcccgctcgttgcc
gaagccgtgacgaacgaaaagctgacccgccgaatcgtaggtgaaacgatcgacgaagtg
ccgtgcatctttctcgaatcgctgcaccgcgccgaaacgggcgtcgcctcggcgctgcac
cgactgaagcgtggccccctgccgtgggagccgcttgatccgcacgatgtgctgccgtgg
atcgaggagcagaccggccttgagctctccccttcgcaacgcagcgcggtgacactcgtg
ctggccagcaaagtatcgatcatcaccggcgggccgggcgtcggcaagaccaccatcctc
aaggcgatcctctcggtgcttcagcgcgaaaaggtctccgtggcgctctgcgctccgacc
ggccgggcagccaagcggctcaccgaatcgaccggtatcgaggccaaaaccatccatcgc
ctgctcgaattcgatccgcagattttcgatttcaaacgaggacgcggcaatccgctcgac
gtttcgttcgtggtggttgacgaaacctcgatggtggacgtcgtgctgatgcagaagctc
gtggcggcgattcccgaccgcgcggcggtggtcttcgtcggcgacgtcgatcagttgcca
tcggttggccccggcgcggtgctcgccgacctgatcgcctcggaggtcatccccaccgtc
tgcctgaccgaaatcttccggcaagccgccgaatcgatgatcgtcgtcaacgcccaccgc
atcaaccagggcgaaatgccgctgaccgacgagggcgaggagctttccgatttctacatc
gttccggcaagttccccggaggcgattcacgacaaggtgatgcagctcgtcacggagcgc
atcccgaaacgcttcgatctagacccggtgcgtgacgtgcaggtgctgacaccgatgaac
aagggcggcatcggcgtacaggccctgaacgccgagctgcaggcgcgcctcaacccgacc
gccgagccgaaagtgacccgcttcggcagcaccttcgcgccgggtgacaaagtgattcag
acagtcaacaactacgacaaagaggtcttcaacggcgacattggcctgatcgaacagatc
gacaccgatgcggagacgctgacggcgctcttcgaccatcaccacgtcgagtacgacttc
agcgacctcgacgaactgtcgctcgcctatgccatcagcatccacaaaagccagggctca
gaatacccggcagtggtcattccgctctccatgcagcactaccccctgctcgaacgcaac
cttgcctatacggccgtcacgcggggacgcaagctcgtggtcatcgttgccgaaccgaag
gcgcttgaccgggcgatcaggaactgtaaatcgaaacgccgcctgaccggcctcgtgcaa
cggctcaaagagtccggaaaacaaagctggcaaaatttgtaa

DBGET integrated database retrieval system