KEGG   Chlorobaculum parvum: Cpar_0835Help
Entry
Cpar_0835         CDS       T00725                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cpc  Chlorobaculum parvum
Pathway
cpc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpar_0835
DNA repair and recombination proteins [BR:cpc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cpar_0835
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cpar_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 IMS_HHH HHH_8
Motif
Other DBs
NCBI-ProteinID: ACF11251
UniProt: B3QMU8
Position
907614..908228
Genome map
AA seq 204 aa AA seqDB search
MRYSSGAVEALIEEFAKLPGIGRKTAQRLTMHVLQERRGEVEKLAAALIDVKEKVVRCSI
CQNITDLGTDPCLLCTSTGRDRSVICVVESPTEVLAFEKTGHYKGLYHVLHGVISPLDGV
GPDDIKVRELLARISPDSEGGVREVVLALNPTVEGETTSLYISKLLKPLGINVTRIARGI
PVGAELEFIDEATLSRAMDGRSAV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacagctcaggagccgtcgaggcgctcatcgaagagtttgccaaactgcccggt
attggccggaagaccgcacagcgcctgacgatgcatgtgctgcaggagaggcgcggagag
gttgaaaaacttgcggctgccctgatcgacgtcaaagagaaggtggtgcgctgctcgatc
tgccagaacatcaccgatctcggcaccgacccctgcctgctctgcacctcaacaggtcgt
gaccgctcggtcatctgtgttgtcgaatcgcccacagaagtgctcgcctttgaaaaaaca
ggtcattacaaaggactgtaccacgtgctgcacggggtgatttcgccgctcgacggcgtt
ggtcccgacgacatcaaagtgcgtgaactgctggctcgaatcagccctgattcggagggc
ggggttcgtgaggtggtactggcgctcaatcccacggtcgagggggaaacgacctcgctc
tatatcagcaaactgctcaaaccactcggcatcaacgtcaccagaatcgccagaggaatt
ccggtgggtgccgagcttgaattcatcgacgaagcgaccctttcgcgggcgatggatggg
cggtcggccgtctga

DBGET integrated database retrieval system