KEGG   Chlorobaculum parvum: Cpar_1029Help
Entry
Cpar_1029         CDS       T00725                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpar_1029
Enzymes [BR:cpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cpar_1029
DNA repair and recombination proteins [BR:cpc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cpar_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD UvrD-helicase UvrD_C DUF2075 AAA_22 T2SSE AAA_28 AAA_16 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ACF11437
UniProt: B3QND4
Position
1138800..1140545
Genome map
AA seq 581 aa AA seqDB search
MIDFIERPIDRQAATFLCRGVTENAELLRTVVSLLSQAVGQGHVCLDLEEIAEELVRISG
QDEPLRLSDAASLITALRSLPTLGGPGEHCPLILDAAGRLYLYRYYRYESLLADAIRARA
ASETDEIDEAALAAQLDRYFGSDESGKDNQRQAALTALRRRFSVISGGPGTGKTTTVARI
LGLLLEQPGGERLRIAMAAPTGKAAARLASSIASLRKTLPCAEEVKRAVPSQVTTIHRLL
GTLPGSTGFRHNERNPLPCDVVIVDEASMVDLPLMTALVTALPPHARLIFIGDRDQLASV
EAGAVLGDICRAAESPGSSIAGCVTVLDRNYRFGDGSGIAALSRAVNAGDDSEALRLLDD
SSSSIVLEATPTRETIKKRLAAPVLEGFRPCLEAETPAAALRLFDRFRILTALREGPWGA
AGMNHAAETLLHEAGLIRRDTPFYRGRPVLVTENDYTHKLFNGDTGIILPDPETGNLRAF
FAAPDGTIRAIPQEFLPRHETAFAMTVHKSQGSEFDRVLMVLPPEDTVLLTRELIYTGIT
RAKQKVAIWSDEAVFSAAVKRRTERRSGLREKLAVTSPGLN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactttatcgaacgacctatcgatcggcaggcggcgacatttctctgccggggt
gtgacggaaaacgcggaattgctgcgcacggtggtttcgctgctcagtcaggcggtgggg
caggggcatgtctgcctcgatctggaggagattgccgaagagctcgtgcggatttccgga
caggatgagccgctgcgcctgtccgacgccgcaagcctcatcaccgctctgcgctcgctg
ccgacgctcggtgggccaggggagcattgcccgttgattctcgacgccgccggacggctc
tatctctaccgctactaccgctacgagtcgctgcttgctgacgccattcgcgcccgcgct
gcgtcggaaacagacgaaatcgatgaagccgcgcttgccgcgcagctcgatcgttacttt
ggttccgacgagtccggcaaggataaccagcggcaggccgcgctgacggcgctccggcgg
cgcttttcggtcatctccggcggccccggcaccggcaaaaccaccacagtcgcgcgcatc
ctcggcctcctgctcgaacaacccggcggagagcgcctgcgcatcgcgatggctgcgccc
accggcaaagccgccgcccggctcgcctcgtccatcgcctcgctccggaaaacgctgcca
tgcgctgaagaggtcaaacgcgccgtcccgagccaggttacgacgatccaccgactgctc
ggcacgctgcccggctcgactggctttcgccacaacgagcgcaacccgctgccttgcgat
gtggtgatcgtcgatgaagcctcgatggtcgatctgccgctcatgaccgcgctcgtcacg
gcgcttccgccgcacgcccggctcattttcatcggcgaccgcgaccagctcgcctcggtc
gaagccggagcggtgcttggcgacatctgtcgcgctgccgaatcgcccggttcctccatc
gccggatgcgtcaccgtgctcgaccgcaactaccgtttcggcgacggctccggcatcgcc
gccctcagccgtgccgtcaacgctggcgacgacagtgaagcgctccgcctgctcgacgac
tccagcagcagcattgtcctcgaagcgacgccgacgcgcgaaacgatcaaaaagcgcctc
gccgccccggtgctcgaagggttccgcccctgcctcgaagccgaaacgcccgccgcagcg
ctgcgcctcttcgaccgcttccgcatcctcaccgccctgcgcgaaggcccgtggggagcc
gccggcatgaaccacgccgccgaaacgctgctccacgaagccggactcatccgccgcgac
acgccgttctaccgtggccgccccgtgctcgtcaccgaaaacgactacacccacaaactt
ttcaacggcgacaccggcatcatcctccccgaccccgaaaccggcaacctccgagccttc
ttcgccgcccccgacggcacgatccgcgccattccgcaagagttcctgcctaggcacgaa
accgctttcgccatgaccgtccacaaaagccagggatcggagtttgacagggttttgatg
gttctgccgccggaggatactgttttgctgacaagggaattgatttataccgggattacg
cgggcgaagcagaaagttgcgatttggagcgacgaggctgttttttcggcggcggtgaag
cgccggacagagcggaggagcgggttgagagagaagttagcagtcacctcacctggtttg
aattga

DBGET integrated database retrieval system