KEGG   Chlorobaculum parvum: Cpar_1541Help
Entry
Cpar_1541         CDS       T00725                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00010  Glycolysis / Gluconeogenesis
cpc00051  Fructose and mannose metabolism
cpc00562  Inositol phosphate metabolism
cpc01100  Metabolic pathways
cpc01110  Biosynthesis of secondary metabolites
cpc01120  Microbial metabolism in diverse environments
cpc01130  Biosynthesis of antibiotics
cpc01200  Carbon metabolism
cpc01230  Biosynthesis of amino acids
Module
cpc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpar_1541
   00051 Fructose and mannose metabolism
    Cpar_1541
   00562 Inositol phosphate metabolism
    Cpar_1541
Enzymes [BR:cpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cpar_1541
Exosome [BR:cpc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cpar_1541
  Exosomal proteins of bladder cancer cells
   Cpar_1541
  Exosomal proteins of melanoma cells
   Cpar_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACF11939
UniProt: B3QPT6
Position
complement(1687956..1688708)
Genome map
AA seq 250 aa AA seqDB search
MRRTIVVGNWKMNNTIAESIELATAIAEKVGATKPECEVGIAPTFPALHEVGKTIEWSGV
QLAAQNCHYENDGAFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNEIVNRKVKKALAE
GLRVILCVGETLDEREAGVTDKIVTAQVVEGLADVSDISTLVIAYEPVWAIGTGKTATKE
QAQDVHASIRSTIEKLYGDSAARHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLKVE
DFMAIIEAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaccatagttgttggcaactggaagatgaacaacaccattgccgagtcgatt
gagctggcgaccgccatcgccgaaaaggtcggcgctaccaagcccgaatgtgaggtcggc
attgcgcccacttttccagcgttgcacgaagtcggcaagacgatcgagtggagtggcgtc
cagcttgcagcccagaactgccattacgaaaatgacggggcgtttaccggcgaggtttcg
acccgcatgcttgccgccgcagggtgcagctacgtcattctcggccactcggagcgccgg
cagttgttcggcgaaaccaatgagatcgtcaaccgcaaagtgaagaaagcgctggccgaa
gggcttcgcgtcatcctgtgcgtcggcgagacgctcgacgagcgcgaggctggcgtgacc
gacaagatcgtcaccgctcaggttgtcgagggactggcggacgtgtcggacatcagcacg
ctggtgatcgcttacgagccggtctgggctattggcaccggaaagacggctaccaaagag
caggcgcaggacgttcatgcctccatccgcagcaccatcgaaaaactgtatggtgattct
gctgcccgccatctgcgcatccagtacggcggaagcgtcaagccgtcgaatgccgcagag
ctgttcgcgatgccggatatcgacggcggtttgattggcggtgcaagcctcaaggtcgaa
gacttcatggccattatcgaggctgcggggtaa

DBGET integrated database retrieval system