KEGG   Chlorobaculum parvum: Cpar_1787Help
Entry
Cpar_1787         CDS       T00725                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpc  Chlorobaculum parvum
Pathway
cpc00230  Purine metabolism
cpc01100  Metabolic pathways
Module
cpc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cpar_1787
Enzymes [BR:cpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cpar_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 AAA_22 Cytidylate_kin AAA NTPase_1
Motif
Other DBs
NCBI-ProteinID: ACF12179
UniProt: B3QQH6
Position
complement(1958780..1959373)
Genome map
AA seq 197 aa AA seqDB search
MPMSDQQDSRQGRLIVFSAPSGTGKSTVAKLVMERLGCLEFSVSATTRAMRAGEEDGVDY
HFLTRERFEQLIEEGGFIEHEFFFGNYYGTLLGKTREAVDAGRNLLFDLDVKGALNLKKI
FGEWALLVFLKPPSMEVLAQRLQSRKSEAPEALAMRLERAEMELACADQFDFVVVNDDLE
RTVDLVASKIAQFLPQS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgagtgaccagcaagattccagacagggccggctgattgtcttttcagcgcct
tcaggcaccggcaagtccaccgtggcgaagctggtgatggagcgtctcggctgcctggag
ttttcggtttcagctaccacccgtgccatgagggccggcgaagaggacggggtcgattat
cattttctgacccgcgaacgtttcgagcaactcatcgaagagggcggttttatcgagcac
gagttctttttcggcaattactacggaacgctgctcggcaagacccgggaggcggttgac
gcaggccggaatcttctgttcgatctcgatgtgaagggggctctgaacctcaagaaaatt
ttcggagagtgggcgctgctcgttttcctcaaacctccgagcatggaggtacttgcacag
cggttgcagtcacgcaaaagcgaggcgccagaggctctggccatgcggctcgaacgggcg
gagatggaacttgcctgtgctgatcagttcgattttgtcgtggtcaatgacgatctcgag
cgcactgtcgatcttgtcgcttcgaagatcgcccagtttcttccacaatcataa

DBGET integrated database retrieval system