KEGG   Clostridium perfringens 13: CPE0557Help
Entry
CPE0557           CDS       T00074                                 

Definition
(GenBank) probable glycine betaine/carnitine/choline ABC transporter
  KO
K05847  osmoprotectant transport system ATP-binding protein
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02010  ABC transporters
Module
cpe_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CPE0557
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpe02000]
    CPE0557
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CPE0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CBS AAA_21 AAA_15 AAA_29 Rad17 AAA_16 G-alpha AAA_5 Endonuc-BglII AAA_22 RsgA_GTPase AAA AAA_30 SMC_N Zeta_toxin AAA_28 AAA_23 AAA_19 Dehydratase_SU AAA_25 AAA_24
Motif
Other DBs
NCBI-ProteinID: BAB80263
UniProt: Q8XMY1
Position
691147..692283
Genome map
AA seq 378 aa AA seqDB search
MIEIKNVSKQIGDRKILDNISLTIDKGSLVVLIGSSGCGKTTTLKLINKLITPTSGEIFI
NEKSLAKENPIELRRNIGYVIQNNGLFPHLTIKENIELIPRLKKGKDVEKIEKTTLDLLN
MVGLDSEIYLNKYPSELSGGQQQRVGFARAFATDAEIILMDEPFSALDPITRTSLQEELF
NIQEELKKTIIFVTHDMDEALKIADKICIMNGGKIAQYDTPENILRNPANDFVRDFIGSD
RVWNNPDFIKAKDIMIKNPVSVKGARTILQGIEIMRSNKVDSLLVIDKENVLKGIVTFKD
IKITNEKSRALSEIMSENPLRVNEDDSLVDILTVMNENSVGFIPVVNSEEKLVGLITRSS
LLSILSDQFLDMEVNIFE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaataaaaaatgtatctaaacaaataggggacagaaagatactagataatatt
tctttaactattgataaaggaagtctagttgttttaataggttctagtggatgtggtaaa
acaactactttaaaacttataaataagttaataacacctacttctggtgaaatatttata
aatgagaaatctttagccaaggaaaaccctattgaattaagaagaaatattggatacgta
attcagaataatggattgtttccacatttaacaataaaggaaaatatagagcttattcca
agactaaaaaagggtaaagatgttgaaaaaatagagaagacaactttagaccttttaaat
atggttggattagattctgaaatttatttaaataagtatccatcagagcttagtggagga
cagcaacagagagtaggttttgcaagagcctttgctacagatgctgagataattttaatg
gacgagccctttagtgctttagatccaataactcgtacttcacttcaggaagagcttttt
aatattcaagaggaacttaaaaagacaattatttttgttactcatgatatggacgaagct
ttaaagatagcagataaaatatgcataatgaatggaggaaaaatagctcaatatgatact
ccagaaaatatacttagaaatccagcaaatgattttgttagagattttataggatcagat
agggtttggaataatcctgacttcataaaagcaaaggatataatgataaaaaatcctgta
tctgttaaaggtgctagaaccatattacaaggaattgaaataatgagaagtaataaggtt
gatagtttattagttattgataaagaaaatgtacttaaaggtattgttacttttaaagat
ataaaaattacaaatgaaaaatcaagagcactttcagaaattatgagtgaaaatccacta
agagttaatgaagatgatagtttagttgatattttaactgtaatgaatgaaaactcagta
ggatttatacctgttgttaactcggaagaaaaattggtagggcttataacaagaagtagt
ttactttcaatattaagcgaccaattcttagacatggaggtgaatatatttgaatag

DBGET integrated database retrieval system