KEGG   Clostridium perfringens 13: CPE0559Help
Entry
CPE0559           CDS       T00074                                 

Definition
(GenBank) RNA polymerase ECF-type sigma factor
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cpe03021]
    CPE0559
Transcription machinery [BR:cpe03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     CPE0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 DUF1492 GerE HTH_10 DUF2089 Clr5 HTH_23 Terminase_5
Motif
Other DBs
NCBI-ProteinID: BAB80265
UniProt: Q8XMX9
Position
694087..694662
Genome map
AA seq 191 aa AA seqDB search
MEKTMSISYLDIDRKNELNEIRLIKESMKGNKESFGILIKNNKEYLYKMAFLYVKDEQDA
LEVIHETVYRAFLNIEKLKKAKFFNTWITRILINVSIDFLKKKGKNEMLDESTPIRKERC
EISTEEKLDLYNAIDLLNDNYKTVIIMMYFNDMKIKDISKVMEIPENTVKTYLRRAKQAL
GEVLKEGYLNE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaactatgagtatatcatatctagatatagatagaaaaaatgaattaaatgaa
attagattaataaaagaatcaatgaaaggaaataaagaatcctttggaatccttataaaa
aacaataaagaatacttatacaaaatggcgtttctatatgttaaagatgagcaggatgct
cttgaagttatacatgaaaccgtatatagagcctttttaaatattgaaaaattaaaaaaa
gcaaagttttttaacacatggattacaagaattttaataaatgtatcaattgattttcta
aagaaaaaaggaaaaaatgaaatgttggatgaaagtacaccgataagaaaagaaagatgt
gaaatatccacagaggaaaagttagatttatataatgcaatagatttattaaatgataat
tataaaacagtaataatcatgatgtactttaatgatatgaaaataaaagatatatcaaag
gttatggaaattccagaaaacacagttaaaacttatttaagaagagcaaaacaagcttta
ggtgaggttttaaaggagggctatttaaatgaataa

DBGET integrated database retrieval system