KEGG   Clostridium perfringens 13: CPE0563Help
Entry
CPE0563           CDS       T00074                                 

Definition
(GenBank) probable transcriptional regulator
  KO
K03486  GntR family transcriptional regulator, trehalose operon transcriptional repressor
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpe03000]
    CPE0563
Transcription factors [BR:cpe03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    CPE0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_11 HTH_36 HTH_DeoR Rrf2 HTH_41 Fe_dep_repress TrmB HTH_5 HTH_45 MarR_2 HTH_12 HTH_Crp_2 HTH_24 DUF4423 HTH_27 LexA_DNA_bind MarR HTH_29
Motif
Other DBs
NCBI-ProteinID: BAB80269
UniProt: Q8XMX5
Position
699647..700354
Genome map
AA seq 235 aa AA seqDB search
MSSKYLKIYNDIVGKIDSGIFEANTKLPSESQLMDEYNVSRDTVRKSLNLLEQNGYIEKS
KGKGSFVLDMNKFDFPVSGIKSFKEIENSLGKECETILEELTLKSPSDSLMKKLEVSPNK
YVWSVVRVRNIDGEKIILDKDYLNSEFVPRLTEEICKDSLYKYIEGELGLKIAYAEKEIT
VQTATEEDQRLLDLRGYDMVAVVKSYTYLEGRKLFQYTESRHRPDKFKFVDFARR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaagtatttaaaaatatataatgatattgttgggaaaatagatagtggaatt
tttgaagcgaatactaaattaccttcagagtcacaacttatggatgaatataatgtatct
agagatactgtaagaaaatccttgaatttattagagcaaaatggatatattgaaaagtct
aaaggtaagggatcttttgtacttgatatgaataaatttgattttcctgtgtcaggtata
aagagttttaaagagattgaaaatagcttaggaaaagagtgcgaaactatattagaggaa
ttaacattaaaaagtcctagtgatagccttatgaaaaaactagaggtttctcctaataaa
tatgtttggagtgtagtaagagttagaaatatagatggtgaaaagataattttagataag
gactatttaaattcagagtttgttccaagacttacagaagaaatatgcaaggattcttta
tataaatatatagagggagaattaggattaaaaatagcctatgctgaaaaagaaataaca
gtacaaactgctactgaggaagatcaaagacttttagatttaagaggatatgatatggta
gctgtggttaaaagctatacatatttagaaggaagaaaattatttcaatatacagagtca
agacatagaccagataaatttaagtttgtagattttgcaagaagatag

DBGET integrated database retrieval system