KEGG   Clostridium perfringens 13: CPE0567Help
Entry
CPE0567           CDS       T00074                                 

Definition
(GenBank) riboflavin synthase alpha subunit
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00740  Riboflavin metabolism
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPE0567
Enzymes [BR:cpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     CPE0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding
Motif
Other DBs
NCBI-ProteinID: BAB80273
UniProt: Q8XMX1
Position
705691..706344
Genome map
AA seq 217 aa AA seqDB search
MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGKDYFTA
YVMGETLRKSNIGNLKKSSKVNLERAMSINSRFNGHIVTGHIDSTGEIISFKDEGEAIWV
EIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIGDLVNI
ECDPIGKYVEKLLGFNKDNRKKKSVLTEEFLTINGFI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttactggtattgtggaagaaataggagaagttataagcatagataaaaatgaaaaa
tcatctttactgaaaataagagctaataaggtcttagaggacaccaagataggtgatagt
atatcaacaaatggagtttgcttaactataacaactaagggaaaagattattttactgca
tatgttatgggagaaaccttaagaaaaagtaatattggaaacttaaaaaaatcaagtaag
gtgaacttggaaagagcaatgagtattaatagcagatttaatggacatatagtaactggc
catattgattccactggagaaataatttcttttaaagatgagggagaagcaatatgggta
gaaattaaagtttcatatgagttaagcaaatatatagtttataaaggctctatagctatt
gatggaataagtttaactattgcagaggttaaaggggaaagttttaaagtttcagtaatt
cctcatagccaagaagagacaacattaactaaaagaaaaattggtgatttagtaaatata
gaatgtgatcctattggtaagtatgttgaaaagcttttaggatttaataaagacaataga
aagaaaaagtctgttttaacagaagagtttttaactattaatgggtttatttaa

DBGET integrated database retrieval system