KEGG   Clostridium perfringens 13: CPE0578Help
Entry
CPE0578           CDS       T00074                                 

Definition
(GenBank) probable ABC transporter
  KO
K10202  N-acetylglucosamine transport system permease protein
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02010  ABC transporters
Module
cpe_M00205  N-Acetylglucosamine transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CPE0578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpe02000]
    CPE0578
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   N-Acetylglucosamine transporter [MD:M00205] [OT]
    CPE0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1240
Motif
Other DBs
NCBI-ProteinID: BAB80284
UniProt: Q8XMW0
Position
719139..719882
Genome map
AA seq 247 aa AA seqDB search
MSSFKTTKEFYASPWALPKSFGFANYMTAFTEANMGAYFFNSILVTIIAMVLSLCLSVPA
SYVLARQKFFGCSFIKNLFMAGLFIQPVYIIVPLFTILEKMKLLNNLFALALVYAVLSLP
FSIYIMSGFMKGIAKDYEEAAMIDGCTNLQILTKIVVPLAKPGIITIMIFNFMNYWNEYA
MAMTFITDADKKTLPVGLQNLMEVQKFATDWGALFAGLVIVMVPTMVIYSLVHKKLTEGV
NIGGVKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttttaaaactactaaagaattctatgcaagtccatgggccttaccaaaaagt
tttgggtttgctaactatatgactgcatttacagaagctaacatgggagcttacttcttc
aactcaatattagttactataatagctatggttttatccctatgtttaagtgtaccagca
tcttatgttttagctagacaaaagttctttggatgtagttttataaagaatctatttatg
gcaggattatttattcaaccagtatatattatagtacctttatttacaatattagaaaaa
atgaaactgttaaataatttatttgcattagctcttgtatatgcagtgctaagcttacct
ttctcaatctatataatgagtggatttatgaaggggattgcaaaggattatgaagaggca
gcaatgatagatggatgtactaatcttcaaatattaacaaagatagtagttccattagct
aaaccaggtattataactataatgatattcaactttatgaattattggaatgaatatgct
atggcaatgactttcataacagatgcagataaaaagacattaccagtagggttacaaaac
ttaatggaagttcaaaagtttgcaactgactggggagcattatttgcaggattagttata
gtaatggtacctacaatggttatatactcactagttcataagaagttaacagaaggtgtt
aatattggtggagttaagggctaa

DBGET integrated database retrieval system