KEGG   Clostridium perfringens 13: CPE0580Help
Entry
CPE0580           CDS       T00074                                 

Definition
(GenBank) probable iron-sulfur binding reductase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4 Fer4_18 Fer4_21 Fer4_16 Fer4_2 Fer4_6 Fer4_4 Fer4_20 Fer4_3 MTTB
Motif
Other DBs
NCBI-ProteinID: BAB80286
UniProt: Q8XMV8
Position
720785..721915
Genome map
AA seq 376 aa AA seqDB search
MRKEVKMTNKELKKNLEDCVNCGLCYKVCPMMNTFGESPKNILRDIDENKISYDEIAYSC
MLCNACTESCPKDINLKEMFQNLRIKSYRENLKNTSKKFNLKVVQNHQKGSFSKFLTSKN
NHKKIKRVFIPGCSLSGYNNEIIFKIKDYLIENLGEVEILLKCCGKPSKDIGNLELFESN
LNDIENNLKIKEVDEIIVACENCYKTFGSAFKDIKVITLWEVINEFGVPKELKNKYSDLK
EEFALHDPCPIKKEEQIHEAVRSILKDLGIKIVEFEKNRSKTECCGCGGMVGVTNKELWL
SQKNERANSTECENIVSYCESCVNTFKSSDKNALHILDFIFNEDVINGKAKSQKNISTIN
QWINRIKLANKVGKES
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagaggtaaaaatgacaaataaggaactaaagaaaaatttagaggactgtgtt
aattgtggactttgctacaaggtatgtccaatgatgaatacttttggagagagtcctaaa
aatatattaagagatatagatgagaataaaataagttatgatgaaattgcatattcttgt
atgctttgtaatgcatgtactgaatcatgtccaaaagatataaatttaaaagagatgttt
caaaatttaagaataaaatcttatagagagaatttaaaaaatactagcaagaaatttaat
ttaaaggttgttcaaaatcatcaaaaaggtagtttttctaagtttttaacatcaaaaaat
aatcataagaaaataaagagagtgtttattccaggttgtagcttaagtggatataacaat
gaaattatttttaaaataaaggactacttaatagaaaatttaggggaagtagagatactt
ctaaaatgttgtggaaagccttcaaaggatattggaaacttagaattatttgaaagtaat
ttaaatgatatagagaataatctaaaaatcaaggaagttgatgaaataatagtagcctgt
gaaaattgttataagacttttggatcagcttttaaagatattaaagtaataacactttgg
gaagttataaatgaatttggagttccaaaggaactaaaaaacaaatattcagatttaaaa
gaagaatttgccttgcatgatccatgtcctataaaaaaagaagaacaaattcacgaagct
gttagaagcatacttaaagatttaggaattaaaatagtagaatttgagaagaatagaagt
aaaactgaatgctgtggttgtggaggaatggtaggagttacaaataaggaattatggcta
agtcaaaaaaatgaaagagctaattctacagaatgtgaaaatatagtttcttactgtgaa
tcctgcgtaaatacctttaaatcttcagataaaaatgcactacacatattagactttatt
tttaatgaagatgttattaatggcaaagctaaaagtcaaaagaatataagcacaattaat
caatggataaatagaattaaattagcaaacaaagtaggaaaagagagttaa

DBGET integrated database retrieval system