KEGG   Clostridium perfringens 13: CPE0583Help
Entry
CPE0583           CDS       T00074                                 

Definition
(GenBank) probable phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CPE0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: BAB80289
UniProt: Q8XMV5
Position
723576..724574
Genome map
AA seq 332 aa AA seqDB search
MSSTLAVTVVIILLTLAFDFINGFHDTATAVATSISTRALSPKAAIALCAVFNFVGAFLG
TEVAKTVGDGIVDQNKIPLWVIAAVILGAIIWNLITWYFGIPSSSSHALIGSLIGGGIAY
SHSINIVSWGTLFDEVILWLILSPIIGLIVGYIFMILLNWALRRCKPGPVNRIFSKLQVV
SGALMALNHGGNDAQKSMGIITMALLSGGFLSTFEVPTWVIALCAIAMATGTSIGGQKII
KTMGSGVAKLNAVNGFAAQTGAAGVIGIATMFHAPVSTTHIITTTIMGVGASKNPKAVKW
GVAKNIVWAWILTIPISACIAAIVVEIFKFVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtactttagctgtaacagttgttattattctcttaacattagctttcgatttt
ataaatggatttcatgatactgcaacggcagttgctacatcaatttccacaagagctctt
tcacctaaggctgccatagctttatgtgccgtatttaactttgttggagcatttttagga
actgaagttgctaaaactgtgggagatggtatagtagatcaaaataaaatacctctatgg
gttattgcagcagttatattaggagctattatatggaatcttattacttggtattttgga
attccaagtagttcttctcatgccttaataggatcattaataggtggaggaatagcttat
tcacattcaataaacatagtaagttggggaactctttttgatgaagtaattctttggctt
atattatcaccaattataggtttaatagttggatacatatttatgattttattaaactgg
gcactaagaagatgcaaaccaggccctgtaaatagaattttctcaaaattacaagtggtt
tcaggagcattaatggccttaaaccatggtggtaatgatgctcaaaaatcaatgggtata
attactatggcacttttaagtggaggatttttatctacttttgaagtaccaacttgggtt
atagctttatgtgcaattgcaatggcaacaggaacttcaataggtggtcaaaaaataatt
aaaacaatgggaagtggagttgctaaattaaatgctgttaatggatttgcagcacaaact
ggggcagctggagttataggaatagctactatgttccatgcacctgtaagtacaactcac
ataataacaactaccataatgggagttggagcttctaaaaaccctaaagcggttaaatgg
ggagttgctaagaatatagtttgggcttggatattaacaatcccaataagtgcatgcata
gctgctatagtagttgaaatatttaaatttgtattatag

DBGET integrated database retrieval system