KEGG   Clostridium perfringens 13: CPE0599Help
Entry
CPE0599           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe03420  Nucleotide excision repair
cpe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CPE0599
   03430 Mismatch repair
    CPE0599
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpe03400]
    CPE0599
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPE0599
DNA repair and recombination proteins [BR:cpe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CPE0599
   MMR (mismatch exicision repair)
    Other MMR factors
     CPE0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 DUF2075 UvrD_C DEAD PhoH Viral_helicase1 AAA_30 UvrD_C_2 T2SSE ResIII AAA_18 TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: BAB80305
UniProt: Q8XMT9
Position
748076..750196
Genome map
AA seq 706 aa AA seqDB search
MTDKKDIEFLVEEKKLEEVSNILNEEMLSYINKRKFVTQYILDYRKNAVEEYKDDEDKLI
EYFDHERYVKEQAFTTIDKKLKELTILKESPYFGRVTFNDLEFDQKDTLYVGRFGVTPEG
SYEPVIVDWRAPVASLFYHGSLGEASYTSPDGPIKCDIEGRRQIIVKKGELKGVFDSAID
VKDDILQMVLSNNSSDKLKDVIMTIQQEQDEIIRKERTSNIVVNGVAGSGKTTIALHRVA
YLLYNYRKELEDKVIILGPNGIFMEYISQVLPSLGEVGVKQETFASFALKEMDSELYIMS
FDKYLEKILSEDIEFIEDAKYKNSYEIIEDLDNLVKEMDKDYFHVEDVKYFGDLVISKEE
IEEMFNKHYEYMPLFRRSEKIKRIILSKIKDKRDEKVWELNEELRKEKEKLTPEELLIEE
NNLEFRRKLRIREIVKEVMDSRAKLDRWISREDVLDIYDRFNGNKKEYTINDLAPILYLA
IKLEGKKATKDYRHVVIDEAQDYSPLQFKVVRELTGTKYFTVVGDVNQRLIKYSDLAPMM
ELGKIFDDVNPEIYNLNKSYRSTYEIMEYANKYLDEDRIIPIVRHGKPVEEIEFHNDEEL
SESIIESLKEFSNEGLESIAIITRDKEELEKVYNLISNKVHLVKFDNEDVLYKGGNVIIP
SYFAKGLEFDGVIIVDNGSSKDENEDLIKYIMSTRALHRLKEIQFK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaaaagatatagaatttttagttgaagagaaaaaattagaggaagtttct
aatatattaaatgaagaaatgctttcatatataaataaaagaaaatttgtaacacaatat
atattagattatagaaaaaatgcagttgaagaatataaagatgatgaagataaattaata
gagtactttgaccatgaaagatatgtaaaagaacaagcctttactacaatagataaaaaa
ttaaaggaattaacaatcttaaaggaatcaccttactttggaagagttacttttaatgat
ttagagtttgatcaaaaggatactttatatgttggtagatttggagtaactccagaggga
agctatgagcctgtaatagtagattggagagcccctgtggcttcacttttttatcatggt
agtttaggagaagcaagttatacatcaccagatggacctataaaatgtgatatagaaggt
agaagacagattatagttaaaaaaggagaattaaagggagtttttgattcagccatagat
gtaaaagatgatattttacaaatggttctaagtaataatagttctgataagcttaaagat
gtaataatgacaattcaacaagagcaagatgaaatcataagaaaagagaggacttctaat
atagttgtaaatggagtagcaggtagtggtaaaactacaatagcacttcatagagttgca
taccttttatataactatagaaaagaattagaagataaagttattatcttaggtccaaat
ggtatatttatggagtatatttcacaagtattacctagtcttggggaagtgggagtaaaa
caggagacttttgctagttttgctttaaaagaaatggatagtgaattatacataatgagt
tttgataagtatttagaaaaaatactttcagaggatatagagtttatagaggatgctaaa
tataaaaattcatatgagataattgaagatttagataacctagtaaaagaaatggataag
gattatttccatgttgaagatgtaaaatactttggtgatttagttatttcaaaagaagaa
atagaagaaatgtttaataaacattatgagtatatgcctttattcagaagaagtgaaaaa
attaaaagaataatattatctaagattaaggataagagagacgagaaagtttgggagctt
aatgaagaattaagaaaagaaaaggaaaaattaactcctgaagaacttttaattgaagaa
aataacttagaatttagaagaaaattaagaataagagaaattgttaaggaagtaatggat
tcaagagctaagttagatagatggatttcaagagaagatgttttagatatctatgataga
ttcaatggaaataaaaaagaatatacaataaatgatttagcaccaatattatacttagca
ataaaattagaaggtaaaaaagcaacaaaagattatagacatgtggttatagatgaagct
caagattattcaccacttcaatttaaagttgtaagagaattaacaggaactaagtatttt
actgttgtgggagacgtaaatcaaagacttattaaatattcagacttagctcctatgatg
gaactaggaaaaatatttgatgatgtaaatccagagatttataacttaaataaaagttat
agaagtacttatgaaataatggaatatgcaaataaatatcttgatgaagatagaataatt
cctatagttagacatggtaaaccagttgaggaaattgaattccataatgatgaagaactt
tcagaaagcattattgagtctttaaaagaattttcaaatgaaggcttagaaagtattgct
attataacaagagataaagaagagttagaaaaggtgtataatcttataagcaataaagtg
catttagttaagtttgataacgaagatgtattatataaaggtggaaatgttataatacca
tcttactttgcaaagggattagaatttgatggggttattattgtagataatggatcatca
aaagatgaaaatgaagatctaataaaatatataatgagtactagagcacttcatagatta
aaagaaatacaatttaaataa

DBGET integrated database retrieval system