KEGG   Clostridium perfringens 13: CPE0601Help
Entry
CPE0601           CDS       T00074                                 

Definition
(GenBank) probable amino acid ABC transporter
  KO
K02029  polar amino acid transport system permease protein
Organism
cpe  Clostridium perfringens 13
Module
cpe_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpe02000]
    CPE0601
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    CPE0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAB80307
UniProt: Q8XMT7
Position
751519..752190
Genome map
AA seq 223 aa AA seqDB search
MGGLDFSFLKEYFPVFLEGAKWTLIISAITVILGALLGTILCFMKRSKFSIFKVKILRVI
STAYVEVIRGTPLLLQIYIVYFGLPSFGIQLEVLLSCIIAISLNSAAYVSEIIRAGIDAV
DKGQLEAARSLGMTEGMAMRLIILPQAIKNILPAIGNEFVAIIKESSMASTIGVAELMYS
SKIVTGATYKGFEPLIVIAMFYFVMTFSLGRVMSYVEKRLSKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggggggattagacttcagctttttaaaagagtattttccagtatttttggaaggtgct
aaatggacattaataatttcagcaataacagttattttaggagctttattaggaacaatt
ttatgctttatgaaacgttccaaattttcaatatttaaagttaaaattttaagggttatt
tctactgcttatgtagaagttataagaggaacacctcttttattacaaatatatatagtt
tattttggattaccttcctttggaattcaattagaggttttactttcatgtattattgct
atttccttaaattcagcagcttatgtttcagaaataataagagcagggatagatgctgtt
gataagggacaattagaagccgctagaagtttaggtatgacagaaggaatggctatgaga
cttataatacttcctcaagctataaaaaatatactccctgctataggaaatgagtttgtt
gccataataaaggaatcatctatggcatctacaattggagtagcagaacttatgtattca
tcaaaaatagttacaggggctacttataaaggttttgaaccacttattgttatagcaatg
ttttattttgttatgacctttagtttaggaagagttatgtcttatgtagaaaagaggttg
agtaaatcatga

DBGET integrated database retrieval system