KEGG   Clostridium perfringens 13: CPE0613Help
Entry
CPE0613           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: BAB80319
UniProt: Q8XMS5
Position
770017..770817
Genome map
AA seq 266 aa AA seqDB search
MYKLVAIDMDGTLLKEDKTVSEKTKEAIKNAREKNVKVVLATGRPVDGVKRYLEELDLCH
DDEYVLTFNGAIVKEVGPDRVICRDTLKGSDLKYLYEISKNVGVNIHAFSNFGCVTPKMN
KYTELEGRINGIEVCEADYNDIKEDEEIIKIMMIDEPEVLEEGIKKLPEEVYEKYTVVRS
APYFLEFLSKTCNKGEGVKSLAESLGIKREEVIAIGDAGNDLHMIEYAGLGVAMGNAFEE
VKEKADFITKSNEEDGVAFVFEKFVL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagtagctatagatatggatggaactttattgaaagaagataaaactgta
tctgaaaaaactaaggaagcaataaagaatgctagagaaaaaaatgtaaaagtagtttta
gcaacaggaagaccagtagatggagtaaaaagatatttagaagaattagatttatgtcat
gatgatgagtatgttttaacttttaacggagctatagttaaggaagttggacctgataga
gtaatttgtagagacactttaaaaggtagcgatttaaaatatttatacgaaataagcaaa
aatgttggagttaatatacatgctttttctaattttggctgtgtaactcctaagatgaat
aaatatacagaattagaaggtagaataaacggaatagaagtttgtgaagctgattataat
gacataaaagaagatgaagaaataataaagataatgatgattgatgaaccagaagttcta
gaagaaggaattaagaagttaccagaagaagtatatgaaaaatatactgtagtaagaagt
gctccttatttcttagagtttttaagtaagacttgtaataaaggagaaggggttaaatct
ctagctgaaagcttaggtataaaaagagaagaagttatagcaattggagacgctggaaat
gatcttcatatgatagagtatgcaggccttggagttgctatgggaaatgcttttgaagaa
gtaaaagaaaaagctgactttattacaaaaagtaatgaggaagatggcgtagcttttgtt
tttgaaaaatttgttttatag

DBGET integrated database retrieval system