KEGG   Clostridium perfringens 13: CPE0617Help
Entry
CPE0617           CDS       T00074                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00521  Streptomycin biosynthesis
cpe00523  Polyketide sugar unit biosynthesis
cpe01130  Biosynthesis of antibiotics
Module
cpe_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CPE0617
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPE0617
Enzymes [BR:cpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CPE0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: BAB80323
UniProt: Q8XMS1
Position
773532..774014
Genome map
AA seq 160 aa AA seqDB search
METYSQKAFEEAGLTMKFVQDNESKSKKGVLRGLHFQTKHTQGKLVRVTQGEVWDVAVDL
RKGSPTFGQWEGVHLSAENKRQFYVPEGFAHGFVVLSDEAVFNYKCTDFYAPEYDSGLLW
NDKYVNVEWPLEGIEEIILSEKDKKQKTLKELDIPFIYEG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatatagtcaaaaagcttttgaagaagctggacttactatgaaatttgttcaa
gataatgaatcaaaatctaaaaaaggtgttttaagaggattacatttccaaactaaacat
actcaaggaaagcttgttagagtaactcaaggagaggtttgggatgtagctgtagattta
agaaaaggatcacctacatttggacaatgggaaggtgttcatttaagtgcagaaaataaa
agacaattctacgttccagaaggatttgctcatggatttgtagttttatctgatgaagct
gtatttaactataaatgtacagatttttatgctccagaatatgacagtggacttctttgg
aatgataaatatgttaatgtagaatggcctttagaaggaatagaagaaataatcttatca
gaaaaagataagaaacaaaaaactttaaaagaattagatattccttttatatatgaaggt
taa

DBGET integrated database retrieval system