KEGG   Clostridium perfringens 13: CPE0621Help
Entry
CPE0621           CDS       T00074                                 

Definition
(GenBank) glycosyltransferase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 DUF1350
Motif
Other DBs
NCBI-ProteinID: BAB80327
UniProt: Q8XMR7
Position
777225..778073
Genome map
AA seq 282 aa AA seqDB search
MIRKFSLIMATYGRKDEVGCFLESLMNSNYPMDKVEVIIVDQNKEIDLEPIISKYKEKIK
VVHIKSNERGLALNRNKGLEIATGDIIAFPDDDCEYLVDTLNIVNNYFENEHCDLLMGRI
VERNGEDSLREWPKEKIEINKNNFYTKCSSVTMFLDSKKCFVKFNDQLGAGKYFGACEDA
DLIYKNCKKGLKIIYNPELQIYHPHYDSNSNMDDKKIYSYGLGFGAMVKSNFDFSMLILF
IKAEGYHFLKSLIYLITFKTTKSKRSWLAFKSRIKGFFEYKN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaattttcattgataatggctacctatgggagaaaagatgaagtagggtgt
tttcttgaaagtctaatgaattcaaattatccaatggataaagttgaagtaatcattgtt
gatcaaaataaagaaatagacttagagcccataattagtaaatataaagaaaaaataaaa
gtggttcacataaaatctaatgaaagaggattagctttaaatagaaataaggggttagag
atagcaactggagatataatagcttttccagatgatgattgtgaatatctagtagatacc
cttaatatagttaataattactttgaaaatgaacattgtgacttattaatgggaagaatt
gttgagcgtaatggtgaagattcacttagggagtggcctaaagagaagatagaaataaat
aaaaataacttttatacaaagtgttcttcagtaactatgtttttagatagtaaaaaatgc
tttgtaaaatttaatgatcaattaggagcaggtaaatattttggagcttgtgaagatgca
gatttgatatataaaaactgtaaaaagggtctaaaaataatatataatccagaacttcaa
atatatcatccacattatgattcaaatagcaatatggatgataagaaaatatatagttat
ggtttaggatttggtgcaatggtaaaatcaaattttgatttttctatgctaatattattt
attaaggctgagggatatcatttcttaaaatcattaatatatttaataacatttaagaca
actaagtcaaaaagaagttggcttgcttttaaaagtagaataaaaggattttttgaatat
aaaaattaa

DBGET integrated database retrieval system