KEGG   Clostridium perfringens 13: CPE0633Help
Entry
CPE0633           CDS       T00074                                 

Definition
(GenBank) tryptophan-tRNA ligase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00970  Aminoacyl-tRNA biosynthesis
Module
cpe_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPE0633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpe01007]
    CPE0633
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpe03016]
    CPE0633
Enzymes [BR:cpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     CPE0633
Amino acid related enzymes [BR:cpe01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CPE0633
Transfer RNA biogenesis [BR:cpe03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CPE0633
 Prokaryotic Type
    CPE0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b DUF3848 Fur_reg_FbpB
Motif
Other DBs
NCBI-ProteinID: BAB80339
UniProt: Q8XMQ5
Position
794912..795910
Genome map
AA seq 332 aa AA seqDB search
MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYDCYFCVVDLHAITVKQLPADLRR
RTLEVLAIYIASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSKKMG
DSIGAGLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKTFTIPEGY
VPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVIRKKISRAVTDSIGIVNYTDEQP
GVKNLINILCAIKGYTPDEVVKMYDGKGYAEFKNDVAEAIVEELAPVQEKVKALLGDKKA
LEEIYKKGAEKANYAAMKTLRKMQKKIGLIPR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaagataagaaaaaaattatttttagtggaataaagccatcaggtgatttaacatta
ggaaattacttaggcgctataaaaaactggactaaattacaagaagaatatgattgttat
ttctgcgttgttgatttacatgccataacagtaaaacaattaccagcagatttaagaaga
agaactttagaagttttagctatatatatagcatcaggaataaatccagaggaaaataca
ttatttatccaatcacatgtaccagctcattcagaagcttcatggcttttaacatgtaat
tcatatatgggtgaattaagcagaatgactcagtataaagataaatcaaagaaaatggga
gattcaataggggcaggattatttaattatccagttcttatggcagctgacatactttta
tataatgcagatcttgttccagtgggaaaagaccaaatgcaacatttagagcttgctaga
gatattggtactagatttaacaattcttatagcaaaacattcactataccagagggatat
gttccaaaagagggagcaaaaataatggatttacaagatccaagcaaaaagatgtctaag
tcagatgctaatccaaatggtttcatattaataatggatgaacctaatgttataagaaag
aaaatttcaagagctgtaacagatagtataggtattgtaaattatactgatgaacagcca
ggagttaagaatttaataaatattctttgtgcaataaaaggatatactcctgatgaagtt
gtaaaaatgtatgatggcaaaggatatgctgaatttaaaaatgatgtagcggaagctata
gttgaagagttagctccagttcaagaaaaggttaaagctttattaggagataaaaaagct
ttagaggaaatatacaaaaagggtgcagaaaaagcaaattatgctgcaatgaaaactctt
agaaaaatgcaaaagaaaataggattaatcccaagatag

DBGET integrated database retrieval system