KEGG   Clostridium perfringens 13: CPE0639Help
Entry
CPE0639           CDS       T00074                                 

Definition
(GenBank) probable phosphate ABC transporter
  KO
K02038  phosphate transport system permease protein
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02010  ABC transporters
Module
cpe_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CPE0639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpe02000]
    CPE0639
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    CPE0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAB80345
UniProt: Q8XMP9
Position
801590..802414
Genome map
AA seq 274 aa AA seqDB search
MRKVKDNILNGLVWLSAIFTIGILVIILGFIFVKGIGKINLTFLTSNYSAGGGGGILPMI
VTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATESLAGIPSIVYGLFGGIF
FVVALKMGYSILAGSLTVSIIILPVIIRTTEEALKTVPESYREASLGLGATKFQTLYKVI
LPSAMPGILSGVILSIGRIIGESAAILLTAGTVAQMPKGIFSSARTLTVQAYLVTKEKGD
IETAAAVGIVLIVIILALNISAKLIAKKFNKANY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttaaagataatatattaaatgggttagtttggttatcagccatatttaca
ataggaattcttgtaattattttaggattcatatttgtaaagggcataggaaaaataaat
ttaacattcttaacaagtaattattcagctggtggcggtggtggaatattgccaatgata
gtaacaactttatggactgttttactttccttagcagtggctactcccataggagttttg
ggagctgtatatttacaagaatatgctaaacaaggaaagatggttaagtttataagattt
gctactgaaagtttagcaggtattccttcaatcgtttatggattatttggaggtatattc
tttgtagtagctttaaaaatggggtattcaattttagcaggttcattaacagtatcaata
ataatcttacctgtaataattagaacaacagaagaggcattaaaaactgtgccggaatca
tatagagaagcatccttaggattaggtgctacaaagtttcaaactttatataaagtaata
ttaccaagtgcaatgcctggaatactttcaggagtaatattatcaataggacgtataata
ggggaatcagcagctatattacttactgctggaactgttgcacaaatgccaaaaggaatt
ttttcaagtgcaagaacacttacagttcaagcttaccttgtaacaaaggaaaaaggagat
atagaaacagcagcggcagttggaatagttcttatagttataatactagcattaaatatt
tcagctaagttaatagctaaaaaatttaataaggcaaactattaa

DBGET integrated database retrieval system