KEGG   Clostridium perfringens 13: CPE0653Help
Entry
CPE0653           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07099  uncharacterized protein
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CPE0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2 HMG_box
Motif
Other DBs
NCBI-ProteinID: BAB80359
UniProt: Q8XMN5
Position
816062..816754
Genome map
AA seq 230 aa AA seqDB search
MALYAISDLHLALNTDKPMDIFGEKWRNHHEKIKENWNNKITEEDTVLIAGDISWSMKSD
ESKDDLDWIDALPGKKIIIKGNHDYWWGSISKLNKMYENTKFIQNNFFTYKDWAICGSRG
WICEGSDKFTQKDKKIFDREQIRLRLSLEEAKKAGYEKIICMVHYPPTNEKFEDSAFINI
FKEFGVDKVIYGHLHGMALKGKVLNEERDGIEYKLTSCDFINFDPIKILD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcgttatatgctatctctgatttgcatttagcacttaatacagataaaccaatggat
atctttggtgagaagtggcgtaatcatcatgagaagataaaagaaaattggaataataaa
attactgaggaagatactgttttaatagcaggggatatttcttggtcaatgaaatcagat
gaaagtaaagatgatttagattggatagacgcacttccaggtaaaaagataataattaaa
gggaatcatgattattggtggggaagtatttctaagttgaataaaatgtatgaaaataca
aagttcatacaaaataatttttttacatataaagattgggctatatgtggaagtagagga
tggatttgtgaaggttctgataaattcacacaaaaggataaaaagatttttgatagggaa
cagataagattaagattatctttagaagaagctaaaaaggcaggatatgaaaagataata
tgcatggtacattatccacctacaaatgagaagtttgaggattcagcctttatcaatata
tttaaagagtttggtgttgataaggttatttatggtcatcttcatggtatggcacttaag
ggtaaagtattaaatgaagagagagatggaatagagtataagcttacaagctgtgatttt
ataaattttgacccaataaaaatcttagattaa

DBGET integrated database retrieval system