KEGG   Clostridium perfringens 13: CPE0656Help
Entry
CPE0656           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 AAA Sigma54_activat AAA_16 AAA_3 ABC_tran AAA_22 NACHT AAA_24 RsgA_GTPase RuvB_N AAA_18 AAA_14 AAA_2 Hpr_kinase_C ATP-synt_ab RNA_helicase
Motif
Other DBs
NCBI-ProteinID: BAB80362
UniProt: Q8XMN2
Position
818840..819955
Genome map
AA seq 371 aa AA seqDB search
MDFKEALSTVNLVLMTGEVPLLIGESGIGKTSLAKELSRINNYHLVTIDGNLLKEGEIGG
LPMVEKKEILFKGDVVKKSVTKYATHVKLMEIDDHIEKGEKVLLFIDELNRCEHAVQQEL
MNLILNREINGYKLNEDVYILAAMNPSNKYDNYEDSDYQVIEMDPAQEDRFVWIDISSNL
KEWMSWAMGDGNIHEHIIEFLSTFPEYFHTPNSLETIKATPRSWERVSKAYRVYLANKKN
FSKEILYNALKGNVGSTIAQEFIAYISNLNKPIISNEEIFESDVLGFNIRERIMSENHSR
MYIIAKSALYYLEGLKDYNKELEVFSDLLSCYPKDLRLGIMKEIKSDHSEELYRNLLNED
KFLEAFFEIYS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggattttaaagaagcgttaagtacagttaatttagttcttatgacaggagaagtacct
cttttaataggagaaagtggtataggaaaaacttctttagcaaaggaacttagtagaata
aataattatcatttagttactatagatggaaatcttcttaaagagggagaaataggtggt
ctcccaatggtagagaagaaagaaatcctatttaaaggagacgtagttaaaaaaagcgta
acaaaatatgctacacatgtaaaacttatggaaattgatgatcatattgaaaagggagaa
aaggttcttttatttattgatgaattaaatagatgtgagcatgcagtgcaacaagaactt
atgaaccttatattaaatagagagataaatggatataagttaaatgaggatgtatatata
ttagcagctatgaatccatcaaataaatatgataactatgaagatagtgattatcaggtt
attgaaatggatccagcccaagaagatagatttgtttggatagatattagttcaaatctt
aaagagtggatgagttgggcaatgggagatggaaatatccatgaacatataatagagttt
ttatcaacattccctgaatatttccacactcctaattcgctagaaacaataaaagctact
ccaagaagctgggagagggtttctaaggcttatagagtgtatttggcaaataagaagaac
ttttctaaggaaatattatataatgctttaaagggaaatgtaggctcaacaatagcacaa
gaatttatagcatatataagtaatcttaataagcctattatttctaatgaagaaattttt
gaaagtgatgttttaggatttaatattagagagagaataatgagtgaaaatcattcaaga
atgtatataatagctaagagtgctttatattatcttgagggattaaaggattataataaa
gaattagaagtgttctcagatttattatcttgttatcctaaggatttaagactaggaata
atgaaggaaataaaaagcgatcactcagaagaattatatagaaatttattaaatgaggat
aagttcttagaagcattctttgagatatatagctag

DBGET integrated database retrieval system