KEGG   Clostridium perfringens 13: CPE0660Help
Entry
CPE0660           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_6 Fer4 Fer4_9 Fer4_7 Fer4_14 Fer4_18 Fer4_16 Fer4_21 Fer4_10 Fer4_2 Fer4_8 Fer4_13
Motif
Other DBs
NCBI-ProteinID: BAB80366
UniProt: Q8XMM8
Position
824764..825528
Genome map
AA seq 254 aa AA seqDB search
MVIFFQGCNFKCLYCHNPETINKCTSCGKCVENCEVGALSISEGKVIWDEEECISCDKCI
KLCEHMSSPKLKEYSVEELVKKIEKDSFFIRGITVSGGECTLNSEFLIKLFREVKKLGLT
CFVDTNGNTKLDDELINLTDKFMLDVKSIDEKENIWLTKSSNKLVLENLKKLLELDKMYE
VRTVIAKGLNSEKTVDEVSKIIGDKCRYKLIKYRPFGVREEGIKVHGTISPEDSYMNELK
EKSIANGCIDTIIT
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggttatattttttcaaggatgtaattttaagtgtttgtattgccacaatcctgaaact
ataaataaatgcacctcttgtggaaaatgcgttgaaaattgtgaagtaggtgccttatca
attagtgaggggaaagttatttgggatgaggaagaatgtatttcttgtgataaatgtata
aagctatgcgagcatatgtcttctcctaaacttaaggaatattcagtagaagagcttgta
aaaaagatagaaaaagatagtttttttataagaggaataactgttagtggtggagaatgc
actttaaactctgaatttttaataaaactttttagagaagttaaaaaacttggattgact
tgctttgttgatactaatggtaatactaaattagatgatgaacttataaatcttacagat
aagtttatgcttgatgttaagtcaattgatgaaaaagaaaatatttggctaactaaatca
tcaaataaattagttttagaaaatttaaaaaaattattagagttagacaagatgtatgaa
gttagaactgttatagctaaaggactaaatagcgaaaaaacagtggatgaagtatctaaa
atcattggtgataaatgtagatataaacttataaaatatagaccctttggagttagagaa
gaggggataaaggttcatggaactataagcccagaagatagctatatgaatgaattaaaa
gaaaaatctatagctaatggatgtattgatacaataataacttaa

DBGET integrated database retrieval system