KEGG   Clostridium perfringens 13: CPE0662Help
Entry
CPE0662           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_19 TPR_8 TPR_16 TPR_1 TPR_15 TPR_14 TPR_12 TPR_7 TPR_6 ANAPC3 TPR_11 TPR_17 NARP1 TPR_21 Glyco_hydro_32N
Motif
Other DBs
NCBI-ProteinID: BAB80368
UniProt: Q8XMM6
Position
complement(826452..827255)
Genome map
AA seq 267 aa AA seqDB search
MNIAYDFIIALILAFVLVMMKQYVFALIVVVIYALYKYNKKKPYILAYKGNVSFRNGERE
KALELYKKACTYKNASDSIRLQYAYLTLYLGNLEEATKLLSAIDYDKLPERLRASYTMTD
SLITWKNGDLKKAIENLKNLHTQYEHTTVYETLGYFLILDKRYEEALKYNLLAYEYDQDN
KVIMDNLAQSYYFTGNIEKAKEVYTKLLDEAPGIPEPYYYYGLILRDEGDTKGALESFDK
ALTKRESYLSALNKDKIRAAIQELNIK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagcttatgactttataattgctttaatattagcatttgtattagtaatgatg
aagcaatatgtttttgcactaattgttgtagtaatctatgctttatacaaatataataag
aaaaagccttatattttagcttacaaaggtaatgtttcctttagaaatggtgaaagagaa
aaagctctagaactttataaaaaagcttgtacatataaaaatgctagtgatagcataaga
cttcaatatgcatatcttactctttacttagggaatttagaagaagccactaagcttcta
agtgctattgattatgataaactaccagaaagattaagagcttcttatacaatgacagat
tctcttataacttggaaaaatggtgatttaaaaaaggctattgaaaacttaaaaaatctt
catacacaatatgaacacacaactgtttatgagactttaggttatttcttaatattagat
aaaagatatgaagaagccttaaaatataatcttttagcttatgaatatgatcaagataat
aaggttataatggataacttagctcaatcttattatttcactggaaatatagaaaaggct
aaggaagtatatactaaacttttagatgaggcccctggaataccagaaccatattattat
tatggcttaatcctaagagatgaaggagacactaaaggagctttagaatctttcgataaa
gccttaactaaaagagagtcttatctttcagcccttaataaggataaaattagagctgct
atacaagaattaaacataaaataa

DBGET integrated database retrieval system