KEGG   Clostridium perfringens 13: CPE0668Help
Entry
CPE0668           CDS       T00074                                 

Definition
(GenBank) probable transposase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OrfB_Zn_ribbon OrfB_IS605 DZR zf-piccolo DUF1246 Zn_Tnp_IS91 ArfGap
Motif
Other DBs
NCBI-ProteinID: BAB80374
UniProt: Q8XMM0
Position
831763..832623
Genome map
AA seq 286 aa AA seqDB search
MKILVLDMISITKKTGGRPKFKSKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVK
IENSRNVDGNIKRVTVSRTQSGKYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGY
EEANPKHFRKAEKRLIKLQRDLVRKEYNSKNYHKNRIMIAKLHERIANQRMDFLQKFSTK
LIRENQSIAIEDLRVSNMLKNHKLAKVISEASWSEFRRMLEYKAEWYGREIVIAPPDYAS
SQLCSECGYKNIEVKNLGLREWICPECGTHHQRDLNASINLEKLIA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcttggtgctggatatgataagtattacaaaaaaaacaggtggcagacctaaa
tttaagtctaagaaaaatgaaatacaatcttatactactaaattagtaaaagctaaaggt
aatgtaaatattgagatagtaggtaaaggaattaaactacctaaacttggattagttaag
atagaaaattcaagaaatgtagatggaaatattaaaagagttactgtgagcagaacacaa
tctggtaaatattttgcatctattctttgtgatgtaaatattcaagaattacctaaaata
gataaaaaagttggtgtagatgttggattaaaaacttttgctgtttgttctgatggatat
gaagaagctaatcctaaacactttagaaaggcagaaaaaagacttattaaacttcaaaga
gatttagttcgtaaagaatataactctaaaaactatcacaaaaatagaattatgattgct
aaattacatgaaaggatagcaaatcaaagaatggacttcttacaaaaattttcaactaag
ctaattagagaaaaccaatcaatagccattgaagatttaagagtttcaaatatgcttaaa
aaccacaaacttgctaaagtaatttcagaagcaagttggtcagaatttagaagaatgcta
gaatacaaggctgaatggtatggtagagaaatagtaattgctccaccagactatgcaagc
tctcaactatgttctgaatgtggctataagaatatagaagttaaaaacctaggtctaaga
gaatggatatgtcccgaatgtggaacacaccatcaaagagaccttaatgcttcaataaac
ttggaaaagctgatagcttaa

DBGET integrated database retrieval system