KEGG   Clostridium perfringens 13: CPE1088Help
Entry
CPE1088           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NID
Motif
Other DBs
NCBI-ProteinID: BAB80794
UniProt: Q8XLF4
Position
1290802..1291374
Genome map
AA seq 190 aa AA seqDB search
MENKISLVYENGEFTVYINDEVVTVNKYMDNAIEKFTQTVHNNATPKSIKWESIEEDLKG
IDLKDLEINSEFKTLTYKDMKYFYSTDKIFNMHGGRMQQLLGGYQLFSFIVKMISEKHLE
DYLEVLNFCEDILRCKVTYRTPGSNFIVGSPAFNYGSASYDFATGKVNKGASIEKMSFED
FKKYIFDIIK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaattagcttagtatatgaaaatggagaatttactgtctacataaatgat
gaagtagttacagttaataaatatatggataatgcaatagagaaatttactcaaacagtg
cataataacgctacaccaaaatcaattaagtgggaaagtattgaagaggatttaaaagga
attgatttaaaagatttagagataaatagtgaatttaaaacattaacttataaggatatg
aagtatttctacagtacagataaaatctttaatatgcatggtggaagaatgcaacaatta
ttaggaggatatcaattattctcatttatagttaagatgatttctgaaaaacatttagaa
gattatttagaagttttaaacttttgtgaagatatcttaagatgtaaggttacatacaga
actccaggaagtaactttatagttggcagcccagcttttaactatggatcagcatcatat
gattttgctactggaaaagttaataagggagcttcaatagaaaagatgtcttttgaagat
tttaaaaaatatatatttgatataataaaataa

DBGET integrated database retrieval system