KEGG   Clostridium perfringens 13: CPE1091Help
Entry
CPE1091           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAB80797
UniProt: Q8XLF1
Position
complement(1292677..1293069)
Genome map
AA seq 130 aa AA seqDB search
MYFQELYDSSNMSILIAFIFYLIRIYPSYVMAKKANLKHSWMMFFPVLGEFQMLHLAGLS
YLYFIIYLIPVARFILFVIVFYRILRNFGFGLFMTILGIIFSFIAFLTFWYIVLTDREFI
GDIPREYQEF
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtattttcaagaattatacgattcaagcaatatgagcattttaattgcatttatattc
tacttaataagaatctacccaagttatgttatggctaagaaagctaacttaaaacattca
tggatgatgttctttcctgtacttggagaatttcagatgttacatttagcaggattatca
tacttatattttataatttatttaataccagttgctagatttatactttttgtaattgta
ttttatagaatacttagaaattttggatttggactatttatgactatattaggaatcata
ttttcttttatagcattcttaacattctggtatattgtcctaactgatagagaatttata
ggagatattccacgtgagtatcaagaattttaa

DBGET integrated database retrieval system