KEGG   Clostridium perfringens 13: CPE1092Help
Entry
CPE1092           CDS       T00074                                 

Definition
(GenBank) probable penicillin acylase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBAH
Motif
Other DBs
NCBI-ProteinID: BAB80798
UniProt: Q8XLF0
Position
1293432..1294415
Genome map
AA seq 327 aa AA seqDB search
MCTHIHISSVKNNLYWGRTLDTSFNPFDVDSKVTIVPRNFTLKTQSKPWKTKYAFLGINL
CGSTLFFDGVNEKGLAGGLLFLKACTWDKKENIEKQGLIAINSGEIVTWILSNFESVSDI
KNNISKVVVTSDDIPSLGELGKGNPITAHYTFTDKMGESVVLEPTNHGHFRVFDNTVGVM
ANDPTFDWHMTNLANYIQVQGFNKQQNNLNSKTVITPISNGTGMLGLPGDYTSPSRFVRV
AYLRNLIGDITDEEAPARLFSILNSVWVPKDVERFYEDKKDSDFSSYMCAYDQNLGKLYL
RVFNHIDTMEFSLENVKEDELVTYSVQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtactcatatacatatttcaagtgttaagaataatctttattggggaagaacttta
gatacatcatttaatccatttgatgttgattctaaagtaacaattgttcctagaaatttt
actttaaaaactcaaagtaaaccatggaaaactaaatatgcctttttaggtataaattta
tgtggatctactctgttttttgatggagttaatgaaaaggggcttgctggaggtctttta
tttttaaaggcatgtacatgggataagaaagaaaatatagaaaagcaaggacttatagcc
attaatagtggagaaatagttacttggattttaagcaattttgaaagtgttagtgatata
aaaaataacatatcaaaagttgtagtaacatctgatgacataccatcattaggagagctt
ggaaaaggaaatcctattactgcacattatactttcacagataaaatgggagaatcagtt
gtattagaaccaacaaaccatggacattttcgtgtttttgataatactgtaggggtaatg
gctaatgatccaacatttgattggcacatgactaatttggcaaattatattcaagttcaa
ggatttaataagcaacaaaataatttaaatagtaaaacagttattacaccaatttcaaat
ggtacaggtatgcttggattacctggagattatacttcaccatcaaggtttgtacgtgta
gcatatttaagaaatcttataggagacattactgacgaagaagctccagcacgtttattt
agtattttaaattctgtttgggttccaaaggatgttgaacgtttttatgaagataaaaaa
gactcagatttttcaagttatatgtgtgcatatgaccaaaacttaggtaagttatattta
cgtgttttcaatcatatagatacaatggaattctctttagaaaatgttaaagaagatgaa
ttagtaacttattcagttcaataa

DBGET integrated database retrieval system