KEGG   Clostridium perfringens 13: CPE1093Help
Entry
CPE1093           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06168  tRNA-2-methylthio-N6-dimethylallyladenosine synthase [EC:2.8.4.3]
Organism
cpe  Clostridium perfringens 13
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpe03016]
    CPE1093
Enzymes [BR:cpe01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.3  tRNA-2-methylthio-N6-dimethylallyladenosine synthase
     CPE1093
Transfer RNA biogenesis [BR:cpe03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferases
    CPE1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM UPF0004 TRAM TRAM_2 HEPN-like_int
Motif
Other DBs
NCBI-ProteinID: BAB80799
UniProt: Q8XLE9
Position
1294599..1295942
Genome map
AA seq 447 aa AA seqDB search
MTLENNMDKKLFCISTYGCQMNEEDSEKLSGMLKSQGYERTENKEEASIIIFNTCCVREN
AENKVFGNLGQLKQLKKKNPNLVIAICGCMMQQVGMADKVLKTFPYVDIIFGTHNAHKFP
EYLHRVLQEGVQVKEILNKEEGIVEGLPIDRKSDVKAFVTIMYGCNNFCTYCIVPYVRGR
ERSRKSEDIIKEIEELVSQGYKEITLLGQNVNSYGKGLEEDIDFAGLLRKVNEVKGLERV
RFMTSHPKDLSDDVIMAIKECDKLCEQVHLPVQSGSSRILKEMNRHYDREYYLDLVKKIK
SEIPDVTLTTDIIIGFPGETEEDFLDTLSLCEEVGYDSAFTFIYSRRNHTPADKMENQIP
DDIKHDRFNRLVEAINKKVVIKNKEYEGKVVEVLVEGPSKNDETKLTGRTRNGKLVNFAG
DEKLVGELVNLKIVRAQPFSLIGEIVE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaaaataacatggataaaaaactcttctgtatttctacatacggatgccaa
atgaatgaagaagattcagaaaaattatcagggatgttaaaatctcaaggatatgaaaga
actgaaaataaagaagaggcttctattataatctttaatacatgttgtgtaagagaaaat
gctgaaaataaggttttcggtaatcttggacaacttaagcaattaaaaaagaaaaatcct
aacttagtaatagcaatttgtggatgtatgatgcaacaagtaggtatggcagacaaagtc
ttaaaaactttcccttatgttgacataatatttggaacacataatgcccataaattccct
gaatacctacatagagtacttcaagaaggtgttcaagttaaggaaatattaaacaaagaa
gagggaatcgttgaaggattacctatagatagaaagagtgatgttaaagcattcgttact
atcatgtatggatgtaacaatttctgtacatactgtatagttccttacgttagaggaaga
gaaagaagtagaaaatctgaggatatcataaaagaaatagaagaattagtatctcaagga
tataaagaaataactttattaggacaaaacgtaaactcatatggaaaaggcttagaagaa
gatatagattttgctggtcttttaagaaaggttaatgaagttaaggggttagagagagtt
agatttatgacttctcatcctaaggatttaagtgatgatgttatcatggctataaaagaa
tgtgataagctttgtgaacaagttcacttaccagttcaaagtggatcatcaagaatatta
aaagagatgaatagacactatgatagagagtactacttagatttagttaagaaaataaaa
tctgaaataccagatgttactttaacaactgatataatcattggattcccaggagaaact
gaagaggacttcttagatacattaagtctttgtgaagaagttggatatgattcagcattc
acatttatctattcaagaagaaatcatactcctgctgacaaaatggaaaatcaaattcca
gatgacataaagcatgatagattcaatagattagttgaagctataaacaaaaaggttgta
ataaaaaataaagaatatgaaggtaaagtagttgaagttcttgttgaaggaccaagtaag
aatgatgaaactaaattaactggaagaactagaaatggtaaattagttaactttgctggt
gatgaaaaactagtaggtgaattagttaacttaaaaatagttagagcacaaccattctca
ttaattggtgaaatagtagaataa

DBGET integrated database retrieval system