KEGG   Clostridium perfringens 13: CPE1094Help
Entry
CPE1094           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00620  Pyruvate metabolism
cpe00680  Methane metabolism
cpe01100  Metabolic pathways
cpe01120  Microbial metabolism in diverse environments
cpe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPE1094
  09102 Energy metabolism
   00680 Methane metabolism
    CPE1094
Enzymes [BR:cpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CPE1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAB80800
UniProt: Q8XLE8
Structure
PDB: 

Position
1296398..1298011
Genome map
AA seq 537 aa AA seqDB search
MKIPCSMMTQHPDNVETYISIQQEPAEAIKGLTPQDKGGLGIEEVMIDFEGKLTPYHQTS
QIALGLISNGIIPGKDVRVTPRIPNANKESVFRQLMSIMSIIETNVQSKELTGTPAISEV
VVPMIETGKEISEFQDRVNSVVDMGNKNYKTKLDLNSVRIIPLVEDVPALANIDRILDEH
YEIEKSKGHILKDLRIMIARSDTAMSYGLISGVLSVLMAVDGAYKWGEKHGVTISPILGC
GSLPFRGHFSEENIDEILATYSGIKTFTFQSALRYDHGEEATKHAVRELKEKIAQSKPRN
FSEEDKDLMKEFIGICSKHYLQTFLKVIDTVSFVSDFIPKNRDRLTKAKTGLEYNREVAN
LDNVADLVKDEVLKQEILSIDNSKEYAVPRAISFTGAMYTLGMPPELMGMGRALNEIKTK
YGQEGIDKLLEIYPILRKDLAFAARFANGGVSKKIIDEEARQEYKEDMKYVNEILNLGLD
YDFLNENEFYHTLLKTTKPIIMHLMGLEENVMRNSTEELKILNEWIVRMGKVRGSIG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaagataccttgttccatgatgactcaacatccggataatgtagaaacttatatttca
atacaacaagaaccagcagaagcgataaaaggattaacaccacaagataaaggtggttta
ggaatagaagaagttatgatagattttgaaggaaagttaacaccttaccatcaaacatca
caaatagcattaggattaatttcaaatggtataattccaggaaaagacgttagagtaact
cctagaatacctaatgcaaataaagaatcagtatttagacaacttatgagtataatgtct
ataattgaaacaaatgttcaatcaaaagaattaactggaactccagcaatctcagaggtt
gttgttcctatgattgaaactggtaaagaaatttcagagtttcaagatagagttaactca
gtagttgatatggggaataaaaactacaaaactaaattagatttaaatagtgttagaata
atacctctagttgaggatgtacctgcactagcaaacatagatagaatattagatgaacat
tacgaaatagaaaagagtaaaggacatattttaaaagatcttagaataatgatagcaaga
tctgatactgctatgtcttatggattaatttcaggagttttatcagttcttatggcagtt
gatggagcttataaatggggagaaaaacatggagtaactataagcccaatcttaggttgt
ggatcacttccatttagaggacatttctcagaagaaaacatagatgaaatccttgctaca
tatagtggaattaaaactttcacatttcaatctgctttaagatatgatcatggtgaagaa
gcgactaaacatgcagttagagaattgaaagaaaaaattgcacaatcaaaacctagaaac
tttagtgaagaagataaagatttaatgaaagaattcataggaatctgttcaaaacattat
cttcaaacattcttaaaggtaatagatacagtttcatttgtatctgactttattcctaag
aatagagatagattaacaaaagctaaaactggattagaatataatagagaagtagcaaac
ttagacaacgtagcggatttagttaaggatgaagtattaaaacaagaaattcttagcata
gataactcaaaagaatatgcagttccaagagctatatcatttactggagctatgtacaca
ttaggaatgccacctgaacttatgggaatgggtagagcattaaacgaaataaaaactaag
tatggtcaagaaggtatagataaacttttagaaatatacccaatcttaagaaaagactta
gcatttgctgctagatttgcaaatggaggagtttctaagaagataatagatgaagaggct
agacaagaatataaagaagacatgaaatatgtaaatgaaattcttaaccttggattggat
tatgatttcttaaacgaaaatgaattctatcatactttacttaaaactacaaaacctata
ataatgcacttaatgggacttgaggaaaatgtaatgcgtaacagcacagaagaacttaaa
atcctaaatgagtggatagtaagaatgggtaaagtaagaggaagtataggctaa

DBGET integrated database retrieval system