KEGG   Clostridium perfringens 13: CPE1095Help
Entry
CPE1095           CDS       T00074                                 

Definition
(GenBank) probable integrase/recombinase
  KO
K04763  integrase/recombinase XerD
Organism
cpe  Clostridium perfringens 13
Brite
Chromosome and associated proteins [BR:cpe03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    CPE1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 Phage_int_SAM_5
Motif
Other DBs
NCBI-ProteinID: BAB80801
UniProt: Q8XLE7
Position
1298199..1299215
Genome map
AA seq 338 aa AA seqDB search
MARILKKNKNELLDILEDYMTDCKYRDLRRTTIRAYEQSLRLLFKFLEDDYKVIYVEDVK
EEHIRNYIDFTKERGKYSYVANENNINSNVPQNRGDFGKKVSLCTLDNYLGNIKMFFTWC
KDNKLISKDPSFKIKRIKYSRKAKAEITIDEFNKLLKSLDLTLFSEYRDYIVIQLLMDTG
MRVGECLELREEDIDIRNKTIFISGEIAKGRRDRYVFFSNTMQRMLQKWLNYKDRYVESN
YIFVTNRGGKYQVHSFEKHMRNYLKKAKIDKQITPHTLRNNFAKRFLMSGGDIYTLSRLL
GHSDIRTTQSAYLDLTTSDIRKNYLKFSPLENMKKKNW
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctaggattttaaagaagaataaaaatgagttgttagatatattggaagattatatg
acagactgtaaatacagagaccttagaaggacaacaattagggcatatgaacaaagttta
agattattatttaagttcttagaagatgattataaggtcatttacgtagaagatgttaag
gaagaacatataagaaattatatagactttactaaagaacgtggtaaatatagctatgta
gctaatgaaaataatattaactccaatgtaccacaaaatagaggagactttggtaagaaa
gtaagtttatgtactttagacaattatttaggaaatattaagatgtttttcacttggtgt
aaggacaataaattaataagtaaagatccatcatttaaaataaaaaggattaaatatagt
agaaaagctaaggctgaaataacaatagatgagtttaataaacttctaaagagtttggat
ttaacattattctcagagtatcgtgactatatagtaatacaacttttaatggatactgga
atgagagttggtgaatgtttagagcttagagaagaagatatagacataagaaataaaact
atatttatatctggagagatagctaaaggtagacgagatagatatgtattctttagtaat
actatgcaaagaatgttacaaaaatggcttaattacaaagatagatatgtagaaagtaat
tatatttttgttactaacagaggtggtaaatatcaagtgcattcatttgaaaaacatatg
cgtaattacttaaagaaagctaaaatcgataaacaaataactccacataccttaaggaat
aactttgcaaaaagatttctaatgagtggaggagatatatatactttatcaagattatta
gggcatagtgatattcgtacaactcaatctgcatatttagatttaacgacatcagatatt
agaaaaaattacttgaagttttctccactagaaaatatgaagaagaaaaattggtaa

DBGET integrated database retrieval system