KEGG   Clostridium perfringens 13: CPE1096Help
Entry
CPE1096           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5387
Motif
Other DBs
NCBI-ProteinID: BAB80802
UniProt: Q8XLE6
Position
1299873..1300172
Genome map
AA seq 99 aa AA seqDB search
MKTGTNTSIIINTRDSKHYRITEKKDRQKKSRAEICIECNNNEDGWCKKHKNWCGKVNYI
CLGVKDPYAKFNNGYNWNNNKSKKKCKKLKNKEYRKTFK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggaactaatacaagtattataattaatacaagagatagcaaacattataga
ataacagagaagaaagatagacagaagaagagtagagctgagatatgtatagagtgtaat
aataatgaagacggttggtgtaagaagcataagaattggtgtggtaaggtgaattatatt
tgtttaggcgttaaagatccttatgcaaagtttaataacggttataattggaataacaat
aagagtaagaaaaaatgtaaaaaacttaaaaacaaagagtatagaaaaacttttaaataa

DBGET integrated database retrieval system