KEGG   Clostridium perfringens 13: CPE1098Help
Entry
CPE1098           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAB80804
UniProt: Q8XLE4
Position
1300712..1301176
Genome map
AA seq 154 aa AA seqDB search
MNIKVGDRLITTRNFLKHGEVGIVTDIYKDEHKQTRVIVKIGLMNLTLYDYELDYYFVKT
NNQIVFMNVSTVKDFLESNKVSSLAKISENGATVISTIINPKELLDTLLQDKDIEERSIC
WTELTTLKHGINMHLKILKDLEKSYNTEYVMHIN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaagtaggagataggttaataactactagaaattttttaaaacatggcgag
gtaggaatagttacagacatatacaaagatgaacataagcaaactagagtaatagttaaa
attggcttaatgaatttaacattatatgattatgaactagattattactttgttaaaact
aataatcaaatagtttttatgaatgtatctacagtaaaagattttttagaatcaaataaa
gttagtagcctagcaaaaatttctgaaaatggagcaacagtaatttctacaattataaat
ccaaaagagttattagatactttgctacaagataaggatatagaagaaagaagtatatgc
tggacagaattaactactcttaagcatggtattaatatgcacctaaaaatattaaaagat
ttagagaaaagttataatacagaatatgtaatgcacataaattaa

DBGET integrated database retrieval system