KEGG   Clostridium perfringens 13: CPE1102Help
Entry
CPE1102           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAB80808
UniProt: Q8XLE0
Position
1302601..1303431
Genome map
AA seq 276 aa AA seqDB search
MTKEQLTEELEGILEKRWWADLEWVKTEDFRLSLLKEVITLTDYYKDTMLTEDDVLKLIN
YSFDIFNIALENSKEYIDDKKVLKVAANPCYWDGEKVFFHGEEYGFTSIKNIELFKSLEL
GEKISLLEAMTGLDQEEKPEYLCLFEYKEDEYLLERDWSGDLEYYTLDEAIDEWMGNDEE
NMIEESKYVDEDSYYIQLLLELQGYQVVILERSRFLDHSHLDEIYKYLKEGYKLIRAVDL
AYVEKAEKLDKQDGWYDNERSMQTFVNNCLYTTLVK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaacaattaacagaagaattagaaggtatattagagaaaagatggtgggca
gatttagaatgggtgaaaacagaagattttaggcttagtttattgaaagaagttatcaca
ttaacagattattataaagatacaatgttaacagaagatgatgtattaaaacttattaat
tattcatttgatatatttaacatagctttagaaaatagtaaagaatatatcgacgataaa
aaagtgttgaaagtggctgctaatccatgttattgggatggagaaaaagttttttttcac
ggagaagaatatggatttacaagcataaaaaatattgaattatttaaaagcttagaatta
ggggaaaaaatatctttattagaagctatgacaggattagatcaagaagaaaaacccgaa
tatttatgtttatttgaatacaaggaagacgaatatttattggaaagagattggagtggc
gatttagaatattatactttagacgaagcaatagatgagtggatggggaacgatgaagag
aatatgatagaagaaagtaaatatgttgatgaggatagttattatatacaactactatta
gagttacaaggatatcaagttgtaatattagaacgttcaagatttttggatcattcacat
ttagatgaaatatataagtatttaaaagaaggatacaaacttattagagctgtagacctt
gcatatgttgaaaaagctgaaaagttagataaacaggatggatggtatgacaatgaaaga
agtatgcaaacatttgtaaacaattgtttatatacaacattagttaaatag

DBGET integrated database retrieval system